KEGG   Viruses: 2546422
Entry
2546422           CDS       T40000                                 

Gene name
WhBvgp3
Definition
(RefSeq) Woodchuck hepatitis virus; X protein
  KO
K21854  HBV protein X
Taxonomy
TAX:35269
  Lineage
Viruses; dsDNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Blubervirales; Hepadnaviridae; Orthohepadnavirus
Organism
vg  Viruses (Woodchuck hepatitis virus)
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 2546422
NCBI-ProteinID: NP_671815
RS: NC_004107
UniProt: P12913
Position
NC_004107:1503..1928
AA seq 141 aa
MAARLCCQLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPA
CFASASGPCCLVFTCAELRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGS
IDPRLSIFVLGGCRHKCMRLL
NT seq 426 nt   +upstreamnt  +downstreamnt
atggctgctcgcctgtgttgccaactggattctgcgcgggacgtccttctgctacgtccc
ttcggccctcaatccagcggaccttccttcccgcggcctgctgccggttctgcggcctct
tccgcgtcttcgccttcgccctcagacgagtcggatctccctttgggccgcctccccgcc
tgtttcgcctcggcgtccggtccgtgttgcttggtcttcacctgtgcagaattgcgaacc
atggattccaccgtgaactttgtctcctggcatgcaaatcgtcaacttggcatgccaagt
aaggacctttggactccttatataaaagatcaattattaactaaatgggaggagggcagc
attgatcctagattatcaatatttgtattaggaggctgtaggcataaatgcatgcgactt
ctgtaa

DBGET integrated database retrieval system