KEGG   Viruses: 26101582
Entry
26101582          CDS       T40000                                 

Gene name
AR657_gp4
Definition
(RefSeq) Woolly monkey hepatitis B virus; X protein
  KO
K21854  HBV protein X
Taxonomy
TAX:68416
  Lineage
Viruses; dsDNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Blubervirales; Hepadnaviridae; Orthohepadnavirus
Organism
vg  Viruses (Woolly monkey hepatitis B virus)
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 26101582
NCBI-ProteinID: YP_009175037
RS: NC_028129
UniProt: Q80MM4
Position
NC_028129:1382..1840
AA seq 152 aa
MAARLCCYLDPERDVLCLRPLQAEPSGRPFSGLSRPAETAAAAAVPAFHGAHLSLRGLPS
CAFSSAGPCALRFTSATWRCMETPMNSVTCLRKKTLGLRTAPPTVMEQYIKDCLFEQWEE
QGEEPRLKVFVLGGCRHKLVGTASPCIFFTSA
NT seq 459 nt   +upstreamnt  +downstreamnt
atggctgctaggctgtgctgctacctggatcctgagagggacgtgctttgtttacgtccc
ctccaagctgaacccagcggacgacccttctcggggttgtctcggcctgctgaaaccgct
gccgcggctgctgttccagccttccacggggcgcacctctctctacgcggtctcccctcc
tgtgccttttcatcggccgggccgtgtgctcttcgcttcacctctgcaacctggagatgc
atggagacccccatgaactctgtcacctgcctgcgtaagaagacccttggactccgcact
gcaccacctaccgtgatggagcaatacatcaaagactgtttgtttgaacagtgggaagaa
caaggggaggagcctaggttaaaggtctttgtattaggaggctgtaggcataaattggtg
ggaactgcctcaccatgcatctttttcacctctgcctga

DBGET integrated database retrieval system