KEGG   Viruses: 26122785
Entry
26122785          CDS       T40000                                 

Symbol
ASN15_gp095
Name
(RefSeq) Turkeypox virus; hypothetical protein
Taxonomy
TAX:336486
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Avipoxvirus
Organism
vg  Viruses (Turkeypox virus)
SSDB
Motif
Pfam: Pox_L5
Other DBs
NCBI-GeneID: 26122785
NCBI-ProteinID: YP_009177116
RS: NC_028238
UniProt: A0A0M3ZK27
Position
NC_028238:97884..98261
AA seq 125 aa
MDKNITLSPVFIEPSFKHSFLKSSNKYFYILIFEIIVTLIIINFFFKEEILNAFIPVPVP
KNAITNLLNKTTLSCEENGTMMIHRESGKYPALNLDGSPIIIDDCSLVLSSLNGRSTSPY
AIFNR
NT seq 378 nt   +upstreamnt  +downstreamnt
atggataaaaatattacattgagccctgtatttatagaacctagttttaaacattctttc
ttaaaatcatctaataaatatttttatattctgatttttgagattatagtaactttaatt
attattaatttcttctttaaggaagagatattaaacgcttttatacctgtacctgtacca
aaaaatgctattactaacttactgaacaaaactacgttgagttgtgaagagaatggtact
atgatgatacatagagaatctggaaaatatccggcgttaaatctagatggttctcctatc
attatcgatgactgtagtttagttttatcttcattaaatggaagatcaacatctccttac
gctatttttaacagatga

DBGET integrated database retrieval system