KEGG   Viruses: 28340396
Entry
28340396          CDS       T40000                                 

Symbol
PTPV-Aus-069, BC341_gp069
Name
(RefSeq) Pteropox virus; entry/fusion imv membrane protein
Taxonomy
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Pteropopoxvirus
Organism
vg  Viruses (Pteropox virus)
SSDB
Motif
Pfam: Pox_L5
Other DBs
NCBI-GeneID: 28340396
NCBI-ProteinID: YP_009268784
RS: NC_030656
UniProt: A0A1B1MRH5
Position
NC_030656:61542..61913
AA seq 123 aa
MSTTVNLSPVFVAPTFEHSLLRADKYIFIELFEFIVVVFLVYVFFKDEIVSMFTPVTPIN
ELDKYKDTYLTCYGNKLYIISDNKQLPALSLNFKQIEFEGCSTILRNINGSRTVRISDVL
NRQ
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtctacaactgttaatttatcgcctgtgtttgtggctcctacttttgagcactctctt
ttacgagcagataaatatatttttatcgaattgtttgagtttatcgtagttgtgttttta
gtatatgtattttttaaagacgagatagtgtctatgtttactcctgtaacgcctataaat
gagttagataaatataaagatacgtatttgacgtgctatggaaataaattatatataatt
agtgacaataaacaacttcctgcactgtcgttaaactttaagcaaatcgagtttgaaggg
tgttcaactattttacgaaacataaatggatcacgcacagtacgtattagcgatgttctt
aacagacaataa

DBGET integrated database retrieval system