KEGG   Viruses: 2943704
Entry
2943704           CDS       T40000                                 

Symbol
YMTVg64R
Name
(RefSeq) Yaba monkey tumor virus; 64R
Taxonomy
TAX:38804
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Yatapoxvirus
Organism
vg  Viruses (Yaba monkey tumor virus)
SSDB
Motif
Pfam: Pox_L5
Other DBs
NCBI-GeneID: 2943704
NCBI-ProteinID: NP_938319
RS: NC_005179
UniProt: Q6TUU9
Position
NC_005179:51566..51964
AA seq 132 aa
MESKKNLYFTPVFIEPTLKHSLLNSYKYTFIIFFEIFIVIILMFIFFKTEIIMSFDKVQS
INNPIDKLKNTFLFCKENKMMIGGLPNNITTEALSVNKLPIVIDNCEDILMSINGSHKVS
LDDIFRRQRFIL
NT seq 399 nt   +upstreamnt  +downstreamnt
atggaatcaaagaaaaatttatactttacacccgtgtttatagagcctactttaaaacat
tcattactaaactcatataagtatacatttattatattttttgaaatatttatagttatt
atactgatgtttattttttttaaaacggaaataatcatgtcttttgataaggttcaaagt
attaataatccaatagataaattaaaaaacacgtttttattctgtaaagaaaataaaatg
atgattgggggattacctaataatatcacaacagaagcgttatccgtaaacaaacttcca
attgtcatagataactgcgaagatattttaatgtcaataaatggatcacataaagtatct
cttgacgatatttttagaagacaacgattcattctttaa

DBGET integrated database retrieval system