KEGG   Viruses: 2949780
Entry
2949780           CDS       T40000                                 
Symbol
CeHV15gEBNA-3B
Name
(RefSeq) Macacine gammaherpesvirus 4; EBNA-3B
  KO
K21856  EBV nuclear antigen 4
Taxonomy
TAX:45455
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Organism
vg  Viruses (Macacine gammaherpesvirus 4)
SSDB
Motif
Pfam: EBV-NA3
Other DBs
NCBI-GeneID: 2949780
NCBI-ProteinID: YP_067966
RS: NC_006146
UniProt: Q9IMX9
Position
NC_006146:join(76628..76993,77075..79495)
AA seq 928 aa
MKKAWLGRALRDGAAEAPDSEDPDSPQDGERGNMGDPGSNPSPRETVSPGPSTASEQMLQ
HEPMEENSDDDVEEVSQRARTPPHGYQEAAALWSARYRTFVNVTPVQASVIQVVHAAYDS
MLFPSSRHVAGLFFDENLTTEEFIWLCMTVRHRCRSVREEPWPIANQRRWRMVSPQRTWP
MGFCTRHLMIENFELWGTSTVRVYLTATLGCEGGERHRVTYSAGTVMPPRMSEFFQKQLT
SFSFADYTRSHSSPRYHMFFDLVSSGRRLYPIWISPWSRDERIAFVQFVGWLCKPEHRLI
HYWFTQCTGRRRPTRPWLKPHPPDVPYENPLTSRDIAIAFACGLAMELYAVRLPNDPIIV
EDGSDESDSESECDPDSAAEALASMPCIIPDPVYIHGRPKVFATSAALKQRRRFRAVLSD
PSVVDALREQCKKQKAGQAEQIAAPTPPKTTQPTPHPQVPTVILHRPHAQPLESQTVPPR
APYPLVPQPPLPHIQVAPVIVHQPPAQVSAPESLLDLLEQDNEDAEQRVMSTFIERSPLP
RPMATRAAPCVYREELDIEEDEPAGLGQIQIQAHLATICPGYTGRSNLKPHGSTHSEPPS
TPRAHIPANSDPRRATFDVLGFRSPDWPPKNWTNANPSTANANASRPISAAPGRARPPAA
APGRARPPAAAPGRARPPAAATGRARPPAAAPGRARPPAAAPGRARPPAAAPGRARPPAA
APGRARPPAAAPGRAAPQQQPQAGPAPQQQPQAGPAPQQQPQAGPASVIVMPPQAPKRGR
PASRKPSRGAKLRPLVPTPDPQGGHTVQAPVFFPPASTPSSQLPRKLGFVRPAGASTAPQ
APTQEPGERRHWEEILPPKRAKTDATVESQPAQGEQLPSFSVIWENLSLGLEPALGQGEF
TTEDGANEGTKGGAAESSPRLEISDEEF
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgaagaaagcttggctcggcagagcattgcgggatggggccgcagaggcaccggattct
gaagacccagattcaccacaggatggagagagaggtaatatgggtgatcccgggtctaat
cccagtccacgtgaaactgtgtccccgggaccgtctactgccagcgagcaaatgttgcaa
cacgagcccatggaagagaattcagatgatgacgtggaagaagtgagccaacgggccaga
acgcccccacacggctatcaggaggccgctgctctctggtcggctcggtatcgaacgttt
gtgaatgtaacaccggtgcaggcgtcagtaatccaagtagtccacgctgcctatgatagc
atgttgtttccctcatcacggcatgtagccggtttgttctttgatgaaaatctgacaacc
gaagagtttatatggctctgcatgactgtgcgtcatagatgccgctctgtccgggaagaa
ccatggcccattgcaaaccaaagacggtggaggatggtgtccccgcagagaacctggccc
atgggattttgtacgaggcacctcatgatagaaaattttgagctttggggcacttcaaca
gtccgggtctatctgacggccactttagggtgtgaaggtggcgagcgccacagagtgact
tacagcgccggtaccgtaatgccgcccagaatgtcagaattttttcagaagcagttgaca
tccttttcgtttgcagattatacccggtcccattcatcgcccagataccacatgttcttt
gatttagtgagttctggtaggagactctatccaatatggatttcaccatggtctagggat
gagagaattgcctttgtgcagttcgtaggatggttatgtaagccggaacacagactcata
cactactggtttacacagtgcactgggagacgccgaccaaccaggccgtggctgaaaccg
catccgcctgatgttccttatgaaaaccccttaacatccagagatatcgctattgccttt
gcctgtggactagccatggagctctatgcggtcagactgccaaatgatcccataattgtc
gaagatggaagcgatgaaagtgactctgagagtgaatgtgacccggatagtgccgcagag
gccctagcgagcatgccatgtataattccggatcctgtgtacattcacggcagaccaaag
gtttttgccacgagtgcagcacttaaacaaagaagaagatttagggccgtcttgtctgac
ccgagtgtagttgatgcacttcgggagcaatgcaaaaagcagaaggcgggacaggcagag
cagatagcagccccaactccaccaaaaacaacacaacccacaccacatccccaagtaccc
acagtgatcctccatagaccacatgcacagccactggaaagtcagaccgtgccaccaaga
gccccttaccccctggtaccgcagccccctttgccacatatccaagtagcacctgtcatc
gttcaccaacctccagcgcaagtcagtgcacctgagtccttactagacctacttgagcag
gataatgaggatgctgaacaacgggttatgtcaacattcatagaacgcagcccactgccc
cgtccaatggccacaagagctgctccctgcgtttatagggaagaactagacattgaagaa
gatgagcccgccggattggggcaaattcagatacaggcacacttggccaccatttgccca
gggtacacaggcaggtccaacctcaagcctcatggctcaacccactctgagccaccttca
accccccgggcacatatacccgccaattcagaccccaggcgggccacctttgatgtcttg
ggcttcagaagcccggattggccacccaagaactggaccaatgcgaaccccagtacggcc
aatgccaatgcgagccgccccatatcagctgccccaggccgggcccgccccccagcagca
gccccaggccgggcccgccccccagcagcagccccaggccgggcccgccccccagcagca
gccacaggccgggcccgccccccagcagcagccccaggccgggcccgccccccagcagca
gccccaggccgggcccgccccccagcagcagccccaggccgggcccgccccccagcagca
gccccaggccgggcccgccccccagcagcagccccaggccgggccgccccccagcagcag
ccccaggccgggcccgccccccagcagcagccccaggccgggcccgccccccagcagcag
ccccaggccgggcccgccagtgtgattgtgatgcctccccaggctcctaaaaggggcagg
cctgccagtagaaagccatcacgtggagctaaactgcgcccactagtgccaactcccgac
ccgcaagggggacatactgtgcaggcacctgtcttttttccaccggccagcacaccttct
tcacaactgcccagaaagctgggtttcgtaaggcccgcgggtgccagcacggcaccccag
gcacccacccaagaacccggagaacggaggcactgggaggaaattctccctcccaaacga
gccaaaaccgatgccaccgtagagtctcagcccgcccaaggagagcaattgccttccttt
tccgttatttgggagaatctcagtctgggcctagagcctgctctaggccagggagaattc
acgaccgaagatggggccaatgaggggaccaagggtggcgccgccgaatcttctcctcgt
cttgaaatatcggacgaggagttctaa

DBGET integrated database retrieval system