KEGG   Viruses: 2949781
Entry
2949781           CDS       T40000                                 
Symbol
CeHV15gEBNA-3A
Name
(RefSeq) Macacine gammaherpesvirus 4; EBNA-3A
  KO
K21855  EBV nuclear antigen 3
Taxonomy
TAX:45455
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Organism
vg  Viruses (Macacine gammaherpesvirus 4)
SSDB
Motif
Pfam: EBV-NA3
Other DBs
NCBI-GeneID: 2949781
NCBI-ProteinID: YP_067965
RS: NC_006146
UniProt: Q9IMY0
Position
NC_006146:join(73534..73845,73933..76446)
AA seq 941 aa
MEEEEVPSTSGVQVQASGMDKDIVVIPDSESSSGEEGERLPDSPPPPPQKGKKRKRRRSD
DASGTTPSQPPCVPQLELGVVEDFGGPQHQTLGKLLHAVSATTLHPNTRAIRLFFGSSIL
TTQRFLAYAMAVRQGVRDRQAIQATIKCQNSWKLTTTASRWRMGYRKHSSWMYSYSDDVR
RPIRIAICVTFACEEGERWNVSYSAGTFKPVRASNYDMVWLTTHRCVGELVELCDPIYHP
FFGYLCIFRCLKFIWENVLLPEQRVPFMQFLGFLQKTDNIYMKRFVQEGLLTSNIQTPWL
SEDPEGAVDRGWTQALIRGRVLGLSGLGPAAEPDKDATGETQQEAEDMESDDEDEIPRIV
SREETKRKDARPPQFLTRTHRLILERTGGLTLRARKALEGPSEPASGGPRRRKECAPEPP
LTLRNLHILAGMFRQQFKGVCAPHVSSPPLVSAVEIPRPQAVQDLEPGPVQSPEPGPVQS
PEAGPVQSPEPGPVQDLEPGPVQDLEPGPVQDLEPGPVQDLEPGPVQDLEPGPVQSPKPG
PTPAPPTGHFVRPWEAAPSQVPKVAPATHMPDPMAGAFDPRPAPLPSLALLTGPAPETSS
SVQVSMSYAAPSWAPTPVQPVVPIPIRCGPPPDYFTWYSSRGRPQRYPYTHPVAVQPPEV
PMAPTEAPLSYPAMQAGRIPVMRPPSRSRGGNEWETRRPYSLQRPRTVRACLAMMRSGTL
GRPPRGEDTETWLERNLSQVAGLRLATGTSAFQGLDQAQVPATPPQLPPRVGAPMSRSIC
RRAPVIPAPPQLPPMPGQWVFIPDQEPLHEASVRPRVSQGPYQMGAFRQVPRVESPPPEP
TNTHAPSFFGVTQYNVSQVSFDEDIEETESADGSEASELCDPIDLSIHGRPTPRTPEVIF
VAEDGQNVSGAGSGVVLVSALVHSGQGEDLPDLEDPPDNEE
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggaagaagaggaggttccatccacctccggtgtccaagtacaggcgtcaggtatggat
aaggacattgtcgtcatacctgattctgaaagtagctcgggggaggaaggagagaggtta
ccagattcaccaccgccaccaccacagaaggggaagaagagaaaacggagaaggagcgat
gacgccagtggcacaacaccgagccagccaccttgtgtcccccagctggagcttggggtg
gtagaagactttggtgggccacaacatcaaactttaggaaagctccttcatgctgtcagt
gccacgactttgcatcccaacacgcgagccatacgcctgttttttggatccagtattctg
actacccagaggttcctggcttatgccatggctgtccgacagggcgttagagatcgtcag
gcaattcaagctacgattaaatgtcagaactcctggaaactgaccaccacggcctcacgc
tggagaatgggttaccggaagcacagcagctggatgtacagctattcggatgatgtgcgg
cgccctataagaattgctatttgtgtaacatttgcatgtgaagaaggcgagaggtggaac
gtgtcctactcagcaggcaccttcaaaccggtgcgggcaagcaattatgatatggtgtgg
ctaaccacacaccggtgtgttggtgagctagtggaactctgtgatcctatctatcatcct
ttctttggctatctgtgcattttccgctgcctgaaattcatctgggaaaatgtgttgttg
cccgagcaacgcgtgccatttatgcagttcctaggctttctacaaaagacggataacatc
tacatgaagcggtttgttcaggaaggcctgctcacctccaacatacaaacgccgtggctg
agtgaagaccccgagggagcagtggacagggggtggacacaagccttaataagggggcgt
gtgttaggtttaagtggtcttggtcccgcggcagagcccgacaaagatgctactggtgaa
acgcagcaagaagctgaggacatggagagtgatgatgaggatgagattcctcgtattgtg
tctcgggaagaaaccaagagaaaagatgcacgcccccctcaatttctaacacgcacgcac
aggctaattcttgagagaacaggggggcttacgctcagggccagaaaggccctggaggga
cccagtgagccagcctccggggggccaagacgcaggaaagagtgtgcaccagaaccccca
ctcacccttagaaacctccacatactagcagggatgttccgtcagcagtttaagggagtt
tgtgcaccccatgtgtcttcacccccattagtttcagcggtcgagatcccaaggccccag
gcagtacaggatctggaacctgggccagtacagagtccagaaccggggccagtacagagt
ccagaagcggggccagtacagagtccggaaccggggccagtacaggatctggaaccgggg
ccagtacaggatctggagccggggccagtacaggatctggagccggggccagtacaggat
ctggaaccggggccagtacaggatctggagccggggccagtacagagtccaaaaccgggg
ccaacaccagccccccccactgggcattttgttaggccctgggaggcagcaccgtcacag
gttcccaaagtagccccggctacacatatgccagatcccatggcaggggcttttgaccca
agacctgctccattgcctagcttggccttacttacaggccccgccccagaaacatctagc
tccgtccaggtgtccatgtcatacgctgccccaagctgggccccaacacctgtccaaccc
gttgtccccattccaatacgttgtggtccacctccggattactttacttggtatagctcc
agaggcaggccccagagatacccctacacacatccggtggctgtacaaccccctgaagtt
cctatggcgcccaccgaggctccgttgtcttacccggccatgcaggcggggagaattcct
gtaatgaggccgccgtcccgatcaagggggggtaacgaatgggagacacgaaggccatat
agcttgcagaggccaaggaccgtgcgtgcgtgtctcgctatgatgcgctctggtactctt
ggcagaccaccccggggtgaggacactgagacgtggttagaacgtaacctgtctcaggtc
gccgggcttcggttggccacaggaacttctgctttccagggtctcgatcaggcccaggtt
ccagcaaccccaccacagctgccaccacgagtgggagcccccatgtctcgctccatttgt
cggcgggctcccgtaattccagcacctcctcagctgccccccatgcctggccagtgggtc
tttataccagaccaagaaccgcttcacgaagcttccgttagaccacgtgttagtcagggc
ccttaccagatgggtgcctttaggcaggtacctcgtgtggaatctccgccccctgaaccc
accaacacccacgctccctcattttttggcgttacccaatataatgtcagccaggtgagc
tttgatgaggatattgaggagacggaaagtgcagatgggtccgaggcttcagagttatgt
gaccctattgatttgtcaatccatggcaggcccaccccaagaacccccgaggtgattttt
gtggcggaggatggccagaatgtgtcaggtgcgggtagtggtgtggttttggtgtcagct
ctggttcactccggtcagggtgaagacttgcctgaccttgaggatcccccagataatgag
gaataa

DBGET integrated database retrieval system