KEGG   Viruses: 2949805
Entry
2949805           CDS       T40000                                 
Symbol
CeHV15ggp350
Name
(RefSeq) Macacine gammaherpesvirus 4; gp350
  KO
K19450  EBV envelope glycoprotein GP350
Taxonomy
TAX:45455
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Organism
vg  Viruses (Macacine gammaherpesvirus 4)
SSDB
Motif
Pfam: Herpes_BLLF1 DUF2158
Other DBs
NCBI-GeneID: 2949805
NCBI-ProteinID: YP_067963
RS: NC_006146
UniProt: O91331
Position
NC_006146:complement(71050..73401)
AA seq 783 aa
MEAAFLLCQYTLQSVFHFAGEDPGFFNIEMLQFPFYPKCEVCTADVNISIVFKVGEANRH
LDLYFGPITPITQNIYQPLHASGGIENVTSLFSLELLGARTMALTMRSIIFPINVSRDEE
HVSMEALYIYFLDAFDILWCQRVQMKEPVYLIPKKMPPVVWNHCNSTNITAVVRAQGMDI
SVPISLPTMPLATKFSLHMEMTSEGIDMLCRNEGDPISPVLPGNNNFAIKCDGDKPHFAS
AGVLTPASPSTTPAPIGGYVYNLTLMPRPVPRFLGNESTLYIMYTEDPDSEHGDFCLKAP
IMFSDKLPTIQDMPAQTQVVLYTGQNATYQLQMAPLENNTAPNVTVTAFWAWANDTSKDF
KCKWMLHTNNQQPVGCERMAGQFLSNRTFELTVEVDNITSKTLIISRAATNVTAVAYQVT
FTKAPDPVTSAPTRQPEDPTLTTPTGMTSPNVTSPTSVSTTPNATSPTSVSTTPNATSPT
SVSTTPNDTSPTTVVSGSTSVATSPPSGATSPNATSPKPASISPTPGVTETPSVITNTPY
PSSIGPSSSPGSGLTSPPRTNYTPRVNSTSVTPPLTSTHETGSKNITETTPEAPNTNHVS
TASPTPPPGTTGQTAGPGNSSTSPEPGATKVTTILPAQNATSPSATSSQETTVPTGTPAG
GKANVTTEPGSGGSTQLPTGGGNSATTVYNATTPPPPTNSSTLRPRWTSTGPPATTTQAT
VPVPPTIKPEGSNLSMLVLQWASLGVLTLLLLLVISDCAFRRSSSRIHTYTHPPYDDEFE
TAV
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggaagcggcttttctgttatgtcaatacaccctccagagtgttttccactttgctggt
gaagatcctggatttttcaatatagagatgctgcagttccccttttatcccaagtgtgag
gtctgcactgccgatgtaaacatctctatcgtcttcaaggttggtgaagctaataggcat
ctggatctctattttggaccgatcacccctattacccaaaacatttaccaaccactccat
gccagtggtggcatcgaaaatgttactagtctcttctcccttgagttgctcggtgctcgt
accatggctttgacaatgcgttccatcatatttccaattaatgtcagtagggatgaggag
cacgttagcatggaagctctatacatttatttcctggacgcatttgacattttgtggtgc
cagcgagttcaaatgaaagaacccgtctatcttataccaaagaagatgccccctgttgtg
tggaaccactgtaattctaccaatataacagctgtggtaagggcacagggaatggacata
tcagttcccataagcttgccaacaatgcctctggcgaccaaattttctctacatatggaa
atgacaagcgaggggattgacatgctgtgccggaatgagggagatcccatttcaccagtt
ttgccgggaaacaacaactttgcaattaaatgcgatggagacaagcctcattttgcgagt
gccggggttctaaccccggcaagccccagcaccacgccggcgcccattggcggctacgta
tacaacctgactttaatgccgcgccccgtgccacgttttctaggcaatgaaagtacactc
tatattatgtatactgaggatccagactctgagcatggggacttctgccttaaggcgcca
attatgttctctgacaaactgcccactattcaggacatgccggcgcaaactcaagtggtg
ttatacactggacaaaatgccacgtatcaactacagatggcgccactggagaacaacact
gcaccaaatgtcacggtgactgccttctgggcctgggcaaatgacacgtctaaggacttc
aagtgcaaatggatgctacacacaaacaaccagcagccagtaggctgcgagagaatggcc
ggccaatttttgtctaatcggacatttgaactcactgtggaggtggacaacataacctcg
aaaacactaattatttcacgtgcagccacaaatgtcaccgctgttgcctaccaggtcact
tttacaaaggcgcctgatccggtaacttctgctccaaccagacaacccgaagaccccacg
ttgaccacgccaactggtatgacatcccctaatgtcaccagccccacctcagtgtccacc
acccctaacgccaccagccccacctcagtgtccaccacccctaacgccaccagccccacc
tcagtgtccaccacccctaacgacacctcacccaccacagtggtctccggctctacatca
gtggcaaccagtcccccatcgggagccacaagccctaacgccaccagccccaagccagcg
tccattagtcccactccaggcgtcactgaaaccccgtccgtcataacaaatacaccttat
ccatcttctataggacctagctccagtcctggctcaggattaacaagcccaccaagaacc
aactatacaccaagggtcaattcaacctcagtcaccccaccgctcacgtctactcatgaa
acaggcagcaaaaatataacagagactacaccagaagctcccaacacgaatcatgtgtcc
accgcttctccaacgcctcccccaggcaccaccggccaaacggcaggccctggaaacagt
tccacatccccagagccgggggcaactaaggtcaccaccatcctacctgcccaaaatgca
acgtcgccctcggccaccagcagtcaggagacgacggttcccactggcaccccagcaggt
ggaaaggccaatgttaccaccgaacctggaagcggaggaagcacacaactgcccacgggt
ggtggaaactcagccacaacagtatacaacgcaaccacccctccacctcccaccaattct
agcacgctacggccccgctggacttctactggcccaccggctaccaccacccaagccaca
gtgccggtcccacccacaattaagcccgagggctccaatctctccatgctagtgctgcaa
tgggcctctctgggtgtactgactcttctgctgttactggtcatatcggactgtgccttc
cgacgcagctcgtccagaatccatacctacacccaccccccatatgatgatgaatttgaa
accgctgtttag

DBGET integrated database retrieval system