KEGG   Viruses: 30671519
Entry
30671519          CDS       T40000                                 
Symbol
BU150_s4gp1
Name
(RefSeq) Hubei insect virus 2; hypothetical protein 2
Taxonomy
  Lineage
Viruses; Other viruses; Riboviria; (no kingdom); (no phylum); (no class); (no order); (no family); (no genus)
Organism
1922898  Viruses (Hubei insect virus 2)
SSDB
Motif
Pfam: Phytoreo_S7 KASH_CCD ATG16 ECM11 HAP1_N TSC22 HALZ DUF3450
Other DBs
NCBI-GeneID: 30671519
NCBI-ProteinID: YP_009329905
RS: NC_032168
UniProt: A0A1L3KNT6
Position
NC_032168:243..3407
AA seq 1054 aa
MGDTANKLGLGFAPPKRQFSLKNIVQASANAANVISSSKPIKTQPLGVGSPLVVTAPPPL
ICPSKPTNTIAKDIASHVPTQLESIPLNVQSSNTDLLKSKMHQRLRIISFQCVSSNAIRQ
IDGQHGVRKVIFAHQVLQCGCNQIPSHNVKIRQLFDDSKSTPNKTHVTIKKIKEYDAETV
LNEIIQYCDQHSHHEKHFTPKSPTIMISGQLKYNDHNLLRRRFALVTLIGNRPQDVVRLN
EYIARYNLESYASSILETKPGECLIVDQSETYHIFAQCMQSADELPQLSIIQQCLTSASY
ELLHLPCKAIIIPTICQLYGLNHFTQVNDILMRMIDQTFDYHTIPVVCTLDGPNAHLSSH
QHDAYSCVPSLYAHKWFERHEHKLIASLDIICNHLITGTSPNPNVTKPPLPTKPKAIKQD
VKPKSDVHPDLDHITTYTSQQPIPPPTDTPVVNKDSPEKVMSESEQNYLFRRWNTLHETN
YNYIYPNNDYKEVLCIILPPGTGKSSILANQPLLIEADEAFTKQDFVDLNTKNDGLVYSR
IVQRCIKEGCYDNKIVMVHSRQHAQLVGMTIIGSFSICANDLTNSDRFQPYMLACAHEAT
LNMLHCEFETYATFAIWFIDVVRPITDVNLLSNVIWEKCHTVSENLDKFRCANASNQQKL
DWERLYHKFNAHVGYDRDEGSTAPVTTAEVHPPPPPNDEVDSVNERQPIPADSKSDDPIA
SETDAPILTSPATVHSDVSDLPITNENHSSIDLLSENQRLLDEIKELREMNANLSKTISE
QKDAIASRDKLVRELTAQIWELTGTNNKHVAENNILRNSLRDCCSNVDDLKRELCTLNEQ
CQSNIQTSHAELSPIAMQQAQQTPPPAMPPIAEEQSEDILARCLYSEIIQPHIADPTDHD
AVDRFKERLRQCLTKSAITKPKRAMTQTISTEATDGVMRRSFSVSCTHEHPKSADSGICS
NDLRDTALFRISGLCRRLDQFSTQELSYFSMHLNYVQNLLLTIEKLLPEKAYMLPVYSPF
FDSFLPTLGNYWSGSFKRVLYTDSPLSTLCDGLY
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgggtgatactgctaataagttaggattaggatttgctcccccaaagagacaattttca
ctcaagaatattgtccaagctagcgctaatgctgcaaacgttatatcatcttccaaacct
attaaaactcaaccccttggggttggatctccattagttgttacggcgcctcctccctta
atctgcccatctaagcccactaacacaattgccaaagatatagctagtcatgttcccact
cagcttgagtccattccactaaacgtacaatcatccaacactgacttgcttaaatctaaa
atgcaccaaagactacgaattatctcattccaatgcgtgtcatctaacgctattagacag
attgatggtcaacatggtgttcgcaaagtgatttttgcccatcaagtactgcaatgtggt
tgtaatcagattccctcacacaatgtaaaaatccgacaactcttcgatgatagcaagagc
accccaaataagacccatgtaaccatcaagaaaatcaaagagtatgatgcagaaactgtc
ttgaatgaaatcattcaatattgtgatcaacatagccatcatgaaaagcacttcacacca
aagtctcctactattatgatatcagggcaactgaaatacaatgatcacaacttattgcgg
cggagatttgctctagttacgttaattggaaatcgcccccaggatgtcgtcagattaaat
gaatacatagcaagatacaatctagaatcatacgcatcgtcgattctggaaactaagccg
ggtgaatgtttgattgttgaccaatctgaaacttaccatatctttgcgcaatgtatgcaa
agtgcggatgaacttcctcagctctccataatacagcagtgtcttacatccgctagttac
gagcttctacacctaccatgtaaagccatcatcattcctaccatttgccaattgtatggt
ctgaaccattttactcaggttaatgacatacttatgcggatgattgatcaaacgtttgac
tatcacactattcctgttgtttgtacgttagatggccctaacgcccacttatcatcccat
caacatgatgcttacagttgtgtccccagtttgtatgcccataaatggtttgaacgacat
gagcataaattaattgcgtcacttgatatcatatgtaaccatcttattactggcacttct
cctaaccccaatgtgactaagcctcctcttccaactaagcctaaggcaattaaacaagat
gtaaaacccaaatctgatgtacatcccgatcttgatcacatcacaacatataccagtcaa
cagcctattcctcctcctactgatacccctgtcgttaataaagacagtcctgagaaggtg
atgtctgagagtgaacaaaactatttgtttcgccgttggaatactctgcacgagactaat
tacaactacatttatcctaacaatgattataaagaagtactgtgcatcatcttgccccca
ggtactggtaaaagctccatcttagcaaatcaacctttacttatagaagccgacgaggca
tttactaagcaggattttgttgacttaaacaccaaaaacgacgggttagtgtattcacgc
atcgtccagcgatgtattaaggaaggatgctatgacaataaaatagtaatggtccacagt
cgtcaacatgctcaattggttggtatgacaataattggttcctttagcatctgtgccaat
gacctcactaacagtgatagatttcaaccctatatgctagcatgtgctcatgaggcaaca
ctaaatatgttacattgtgagtttgaaacatatgctacctttgcaatatggtttattgat
gtagtacgtcccatcaccgatgtaaatctgttgagtaatgtaatctgggaaaaatgtcat
acggtgagtgagaatctagacaaattccgttgtgctaacgcctccaatcagcagaaatta
gactgggagcgcctatatcataagtttaatgcgcatgtaggatatgatagggatgagggt
tctaccgctcctgtaactactgccgaagtccatcctccacccccacctaatgatgaagta
gatagtgtcaatgagcgacagccaattccagctgactccaagagcgatgatcctatcgca
agtgaaactgatgctccaattttaacttctcctgctacagtacatagtgatgtgtcagat
ttgccgatcaccaatgagaaccactcatccatcgacttgttatctgaaaaccaacggctg
ttagacgaaattaaagaattgagagaaatgaatgctaacctaagtaaaaccataagtgaa
caaaaagatgctattgcctctagggacaaactggtgcgtgagttaacagcgcagatttgg
gaacttacaggtactaataataagcatgtagctgagaacaatatcctacgtaatagcttg
cgagattgttgttcgaacgttgatgatctaaaacgtgagctgtgtacgctgaatgaacaa
tgtcagtccaacattcagacgtcacatgctgaactttcacctattgcgatgcaacaggca
caacagacgccacctcctgctatgccacctatcgcagaggaacagtctgaggatatttta
gctcgatgtctctattcggaaatcattcaaccacatattgctgaccctactgatcacgat
gctgttgaccggtttaaagaaagactgcgtcagtgtctcaccaaatccgcaataaccaaa
cccaaaagagctatgacgcaaactatctccactgaggctacggatggggttatgcgcaga
tctttttcggtatcgtgcactcatgaacatcctaagagcgcggatagtggaatttgttcc
aatgatttgcgtgacacagcactcttccgcatttcaggtttgtgcagacgattagatcag
ttttcaacccaggagttatcttacttttcaatgcatttaaattatgtccagaacctcctc
ctaaccattgagaaattacttcctgagaaggcgtatatgttaccagtttattcacctttc
tttgattcatttcttcctactcttggtaactattggagtgggtcatttaaaagagtatta
tatacagactcacctctctctactctctgtgatgggctgtactaa

DBGET integrated database retrieval system