KEGG   Viruses: 3655151
Entry
3655151           CDS       T40000                                 

Gene name
HA, FLUAVH3N2_s4p1
Definition
(RefSeq) Influenza A virus (A/New York/392/2004(H3N2)); hemagglutinin
  KO
K19251  Influenza A virus hemagglutinin
Taxonomy
TAX:335341 [GN:T40037]
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; Insthoviricetes; Articulavirales; Orthomyxoviridae; Alphainfluenzavirus; Influenza A virus; H3N2 subtype
Organism
vg  Viruses (Influenza A virus)
SSDB
Motif
Pfam: Hemagglutinin TBCC_N CoV_S2 DUF3450
Other DBs
NCBI-GeneID: 3655151
NCBI-ProteinID: YP_308839
RS: NC_007366
UniProt: Q464B9
Position
NC_007366:30..1730
AA seq 566 aa
MKTIIALSYILCLVFAQKLPGNDNSTATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQ
SSSTGGICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYDVPD
YASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACKRRSNNSFFSRLNWLTHLKFKYPAL
NVTMPNNEKFDKLYIWGVHHPGTDNDQISLYAQASGRITVSTKRSQQTVIPSIGSRPRIR
DVPSRISIYWTIVKPGDILLINSTGNLIAPRGYFKIRSGKSSIMRSDAPIGKCNSECITP
NGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWE
GMVDGWYGFRHQNSEGTGQAADLKSTQAAINQINGKLNRLIGKTNEKFHQIEKEFSEVEG
RIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFERTKKQLRENAEDMGN
GCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISC
FLLCVALLGFIMWACQKGNIRCNICI
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgaagactatcattgctttgagctacattctatgtctggttttcgctcaaaaacttccc
ggaaatgacaacagcacggcaacgctgtgccttgggcaccatgcagtaccaaacggaacg
atagtgaaaacaatcacgaatgaccaaattgaagtcactaatgctactgaactggttcag
agttcctcaacaggtggaatatgcgacagtcctcatcagatccttgatggagaaaactgc
acactaatagatgctctattgggagaccctcagtgtgatggcttccaaaataagaaatgg
gacctttttgttgaacgcagcaaagcctacagcaactgttacccttatgatgtgccggat
tatgcctcccttaggtcactagttgcctcatccggcacactggagtttaacaatgaaagc
ttcaattggactggagtcactcaaaatggaacaagctctgcttgcaaaaggagatctaat
aacagtttctttagtagattgaattggttgacccacttaaaattcaaatacccagcattg
aacgtgactatgccaaacaatgaaaaatttgacaaactgtacatttggggggttcaccac
ccgggtacggacaatgaccaaatcagcctatatgctcaagcatcaggaagaatcacagtc
tctaccaaaagaagccaacaaaccgtaatcccgagtatcggatctagacccaggataagg
gatgtccccagcagaataagcatctattggacaatagtaaaaccgggagacatacttttg
attaacagcacagggaatctaattgctcctcggggttacttcaaaatacgaagtgggaaa
agctcaataatgagatcagatgcacccattggcaaatgcaattctgaatgcatcactcca
aatggaagcattcccaatgacaaaccatttcaaaatgtaaacaggatcacatatggggcc
tgtcccagatatgttaagcaaaacactctgaaattggcaacagggatgcgaaatgtacca
gagaaacaaactagaggcatatttggcgcaatcgcgggtttcatagaaaatggttgggag
ggaatggtagacggttggtacggtttcaggcatcaaaattctgagggaacaggacaagca
gcagatctcaaaagcactcaagcagcaatcaaccaaatcaatgggaagctgaataggttg
atcgggaaaacaaacgagaaattccatcagattgaaaaagaattctcagaagtagaaggg
agaattcaggacctcgagaaatatgttgaggacactaaaatagatctctggtcatacaac
gcggagcttcttgtggccctggagaaccaacatacaattgatctaactgactcagaaatg
aacaaactgtttgaaagaacaaagaagcaactgagggaaaatgctgaggatatgggcaat
ggttgtttcaaaatataccacaaatgtgacaatgcctgcatagggtcaatcagaaatgga
acttatgaccatgatgtatacagagatgaagcattaaacaaccggttccagatcaaaggt
gttgagttgaagtcaggatacaaagattggatcctatggatttcctttgccatatcatgt
tttttgctttgtgttgctttgttggggttcatcatgtgggcctgccaaaaaggcaacatt
aggtgcaacatttgcatttga

DBGET integrated database retrieval system