KEGG   Viruses: 3783713
Entry
3783713           CDS       T40000                                 
Symbol
BLLF1, HHV4_BLLF1
Name
(RefSeq) Human gammaherpesvirus 4; glycoprotein 350
  KO
K19450  EBV envelope glycoprotein GP350
Taxonomy
TAX:10376 [GN:T40079]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB
Motif
Pfam: Herpes_BLLF1
Other DBs
NCBI-GeneID: 3783713
NCBI-ProteinID: YP_401667
RS: NC_007605
UniProt: P03200 A0A0B6VN60
Position
NC_007605:complement(77142..79865)
AA seq 907 aa
MEAALLVCQYTIQSLIHLTGEDPGFFNVEIPEFPFYPTCNVCTADVNVTINFDVGGKKHQ
LDLDFGQLTPHTKAVYQPRGAFGGSENATNLFLLELLGAGELALTMRSKKLPINVTTGEE
QQVSLESVDVYFQDVFGTMWCHHAEMQNPVYLIPETVPYIKWDNCNSTNITAVVRAQGLD
VTLPLSLPTSAQDSNFSVKTEMLGNEIDIECIMEDGEISQVLPGDNKFNITCSGYESHVP
SGGILTSTSPVATPIPGTGYAYSLRLTPRPVSRFLGNNSILYVFYSGNGPKASGGDYCIQ
SNIVFSDEIPASQDMPTNTTDITYVGDNATYSVPMVTSEDANSPNVTVTAFWAWPNNTET
DFKCKWTLTSGTPSGCENISGAFASNRTFDITVSGLGTAPKTLIITRTATNATTTTHKVI
FSKAPESTTTSPTLNTTGFADPNTTTGLPSSTHVPTNLTAPASTGPTVSTADVTSPTPAG
TTSGASPVTPSPSPWDNGTESKAPDMTSSTSPVTTPTPNATSPTPAVTTPTPNATSPTPA
VTTPTPNATSPTLGKTSPTSAVTTPTPNATSPTLGKTSPTSAVTTPTPNATSPTLGKTSP
TSAVTTPTPNATGPTVGETSPQANATNHTLGGTSPTPVVTSQPKNATSAVTTGQHNITSS
STSSMSLRPSSNPETLSPSTSDNSTSHMPLLTSAHPTGGENITQVTPASISTHHVSTSSP
APRPGTTSQASGPGNSSTSTKPGEVNVTKGTPPQNATSPQAPSGQKTAVPTVTSTGGKAN
STTGGKHTTGHGARTSTEPTTDYGGDSTTPRPRYNATTYLPPSTSSKLRPRWTFTSPPVT
TAQATVPVPPTSQPRFSNLSMLVLQWASLAVLTLLLLLVMADCAFRRNLSTSHTYTTPPY
DDAETYV
NT seq 2724 nt   +upstreamnt  +downstreamnt
atggaggcagccttgcttgtgtgtcagtacaccatccagagcctgatccatctcacgggt
gaagatcctggttttttcaatgttgagattccggaattcccattttaccccacatgcaat
gtttgcacggcagatgtcaatgtaactatcaatttcgatgtcgggggcaaaaagcatcaa
cttgatcttgactttggccagctgacaccccatacgaaggctgtctaccaacctcgaggt
gcatttggtggctcagaaaatgccaccaatctctttctactggagctccttggtgcagga
gaattggctctaactatgcggtctaagaagcttccaattaacgtcaccaccggagaggag
caacaagtaagcctggaatctgtagatgtctactttcaagatgtgtttggaaccatgtgg
tgccaccatgcagaaatgcaaaaccccgtgtacctgataccagaaacagtgccatacata
aagtgggataactgtaattctaccaatataacggcagtagtgagggcacaggggctggat
gtcacgctacccttaagtttgccaacgtcagctcaagactcgaatttcagcgtaaaaaca
gaaatgctcggtaatgagatagatattgagtgtattatggaggatggcgaaatttcacaa
gttctgcccggagacaacaaatttaacatcacctgcagtggatacgagagccatgttccc
agcggcggaattctcacatcaacgagtcccgtggccaccccaatacctggtacagggtat
gcatacagcctgcgtctgacaccacgtccagtgtcacgatttcttggcaataacagtatc
ctgtacgtgttttactctgggaatggaccgaaggcgagcgggggagattactgcattcag
tccaacattgtgttctctgatgagattccagcttcacaggacatgccgacaaacaccaca
gacatcacatatgtgggtgacaatgctacctattcagtgccaatggtcacttctgaggac
gcaaactcgccaaatgttacagtgactgccttttgggcctggccaaacaacactgaaact
gactttaagtgcaaatggactctcacctcggggacaccttcgggttgtgaaaatatttct
ggtgcatttgcgagcaatcggacatttgacattactgtctcgggtcttggcacggccccc
aagacactcattatcacacgaacggctaccaatgccaccacaacaacccacaaggttata
ttctccaaggcacccgagagcaccaccacctcccctaccttgaatacaactggatttgct
gatcccaatacaacgacaggtctacccagctctactcacgtgcctaccaacctcaccgca
cctgcaagcacaggccccactgtatccaccgcggatgtcaccagcccaacaccagccggc
acaacgtcaggcgcatcaccggtgacaccaagtccatctccatgggacaacggcacagaa
agtaaggcccccgacatgaccagctccacctcaccagtgactaccccaaccccaaatgcc
accagccccaccccagcagtgactaccccaaccccaaatgccaccagccccaccccagca
gtgactaccccaaccccaaatgccaccagccccaccttgggaaaaacaagtcctacctca
gcagtgactaccccaaccccaaatgccaccagccccaccttgggaaaaacaagccccacc
tcagcagtgactaccccaaccccaaatgccaccagccccaccttgggaaaaacaagcccc
acctcagcagtgactaccccaaccccaaatgccaccggccctactgtgggagaaacaagt
ccacaggcaaatgccaccaaccacaccttaggaggaacaagtcccaccccagtagttacc
agccaaccaaaaaatgcaaccagtgctgttaccacaggccaacataacataacttcaagt
tcaacctcttccatgtcactgagacccagttcaaacccagagacactcagcccctccacc
agtgacaattcaacgtcacatatgcctttactaacctccgctcacccaacaggtggtgaa
aatataacacaggtgacaccagcctctatcagcacacatcatgtgtccaccagttcgcca
gcaccccgcccaggcaccaccagccaagcgtcaggccctggaaacagttccacatccaca
aaaccgggggaggttaatgtcaccaaaggcacgcccccccaaaatgcaacgtcgccccag
gcccccagtggccaaaagacggcggttcccacggtcacctcaacaggtggaaaggccaat
tctaccaccggtggaaagcacaccacaggacatggagcccggacaagtacagagcccacc
acagattacggcggtgattcaactacgccaagaccgagatacaatgcgaccacctatcta
cctcccagcacttctagcaaactgcggccccgctggacttttacgagcccaccggttacc
acagcccaagccaccgtgccagtcccgccaacgtcccagcccagattctcaaacctctcc
atgctagtactgcagtgggcctctctggctgtgctgacccttctgctgctgctggtcatg
gcggactgcgcctttaggcgtaacttgtctacatcccatacctacaccaccccaccatat
gatgacgccgagacctatgtataa

DBGET integrated database retrieval system