KEGG   Viruses: 3783763
Entry
3783763           CDS       T40000                                 
Symbol
EBNA-3B/EBNA-3C, HHV4_EBNA-3B/EBNA-3C
Name
(RefSeq) Human gammaherpesvirus 4; nuclear antigen EBNA-3C
  KO
K21856  EBV nuclear antigen 4
Taxonomy
TAX:10376 [GN:T40079]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB
Motif
Pfam: EBV-NA3
Other DBs
NCBI-GeneID: 3783763
NCBI-ProteinID: YP_401671
RS: NC_007605
UniProt: P03204 A0A0B6VJ05
Structure
Position
NC_007605:join(86083..86442,86517..89135)
AA seq 992 aa
MESFEGQGDSRQSPDNERGDNVQTTGEHDQDPGPGPPSSGASERLVPEESYSRDQQPWGQ
SRGDENRGWMQRIRRRRRRRAALSGHLLDTEDNVPPWLPPHDITPYTARNIRDAACRAVK
QSHLQALSNLILDSGLDTQHILCFVMAARQRLQDIRRGPLVAEGGVGWRHWLLTSPSQSW
PMGYRTATLRTLTPVPNRVGADSIMLTATFGCQNAARTLNTFSATVWTPPHAGPREQERY
AREAEVRFLRGKWQRRYRRIYDLIELCGSLHHIWQNLLQTEENLLDFVRFMGVMSSCNNP
AVNYWFHKTIGNFKPYYPWNAPPNENPYHARRGIKEHVIQNAFRKAQIQGLSMLATGGEP
RGDATSETSSDEDTGRQGSDVELESSDDELPYIDPNMEPVQQRPVMFVSRVPAKKPRKLP
WPTPKTHPVKRTNVKTSDRSDKAEAQSTPERPGPSEQSSVTVEPAHPTPVEMPMVILHQP
PPVPKPVPVKPTPPPSRRRRGACVVYDDDVIEVIDVETTEDSSSVSQPNKPHRKHQDGFQ
RSGRRQKRAAPPTVSPSDTGPPAVGPPAAGPPAAGPPAAGPPAAGPPAAGPPAAGPRILA
PLSAGPPAAGPHIVTPPSARPRIMAPPVVRMFMRERQLPQSTGRKPQCFWEMRAGREITQ
MQQEPSSHLQSATQPTTPRPSWAPSVCALSVMDAGKAQPIESSHLSSMSPTQPISHEEQP
RYEDPDAPLDLSLHPDVAAQPAPQAPYQGYQEPPAPQAPYQGYQEPPPPQAPYQGYQEPP
AHGLQSSSYPGYAGPWTPRSQHPCYRHPWAPWSQDPVHGHTQGPWDPRAPHLPPQWDGSA
GHGQDQVSQFPHLQSETGPPRLQLSLVPLVSSSAPSWSSPQPRAPIRPIPTRFPPPPMPL
QDSMAVGCDSSGTACPSMPFASDYSQGAFTPLDINATTPKRPRVEESSHGPARCSQATAE
AQEILSDNSEISVFPKDAKQTDYDASTESELD
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggaatcatttgaaggacagggggactctagacagtcacccgacaatgagcggggagat
aatgtacagactaccggcgagcatgatcaggaccctgggccggggcctccatccagtggg
gcttctgagagattggtaccagaagagtcatactcaagagatcagcaaccttgggggcaa
agcaggggtgatgaaaacagaggctggatgcagcgcatcaggcgaaggcggagaagacgg
gctgccttgtccggccatcttttagacacggaagacaatgtgccgccatggttgcctcca
cacgacatcacaccatataccgcaaggaatatcagggatgctgcctgccgggctgtcaag
caatcgcacctgcaagcgctatcaaacctgatactcgatagtgggttagacacacaacac
atcttgtgcttcgtgatggcagccaggcagcgtcttcaggacattcgacgtggacccttg
gttgcggagggcggtgtgggttggcgacattggcttctaacatctcccagccaatcctgg
cccatgggatatcgtacagcaacactacgcacattaactcccgtgcctaacagggttggg
gctgacagcatcatgttaactgccacatttggatgccaaaatgcggcacgaactctaaac
accttctctgccaccgtgtggacaccaccccatgctggaccaagagagcaagaaagatac
gctcgggaagccgaggtacgcttccttcgtggtaaatggcagaggcggtaccgaagaatc
tatgatttgatagaactgtgtggctctctgcaccacatctggcaaaacttgctccagacc
gaggagaaccttttagatttcgtgcgtttcatgggtgtcatgtccagctgcaataatcca
gctgtgaattactggtttcacaagacaatcggaaactttaagccatattacccgtggaat
gcaccacctaatgaaaatccatatcacgcgcggagaggcataaaagaacacgtaatccag
aacgcatttcgaaaggcacaaatacagggtttatcaatgttagcaacgggaggtgaaccc
agaggtgatgctactagtgaaacgagcagtgatgaggacaccggtagacagggttcggac
gtggagctagagtcctcggacgatgagctgccatatatcgatcccaatatggagccggtt
cagcagaggcccgtcatgtttgtgagccgtgtgcctgcaaagaaaccgaggaaactgcct
tggcccacgcccaagacgcacccagtgaagcgcacaaatgttaagacctctgatagatct
gataaggcagaagcacaaagcacccctgaaaggccgggcccttccgaacaatcatcagtg
accgtggagcccgcccacccgaccccggtggagatgccaatggtgattctccatcaacca
cctccagtgcccaaaccggttccagtcaagcctacgccaccgccttcccgtaggagaagg
ggagcgtgtgttgtgtacgacgatgatgtcatagaggtgattgatgttgaaaccaccgaa
gattcatcgtcagtgtcacagccaaataagccacatcggaaacatcaagacggctttcaa
cgttcaggccgacgtcaaaaacgagccgcgcctcccaccgtgagtccttcggatactggg
cctcctgccgtggggcctcctgccgcggggcctcctgccgcggggcctcctgccgcgggg
cctcctgccgcggggcctcctgccgcggggcctcctgccgcggggcctcgcatactggcg
cctctttccgctgggcctcctgccgcggggcctcacatagtgacgcctccttccgcccgg
cctcgtataatggcgcctcccgtcgtacgtatgtttatgagggagcgacagctcccccag
tccaccggccgtaaacctcagtgcttctgggaaatgcgggctggtcgtgaaattacacaa
atgcaacaagaaccaagttcacacctgcagtccgccactcagcctacaacgcctcgccca
tcatgggccccatcagtctgcgccctctcggtgatggatgctggtaaggcccagcccata
gaaagttcacacttgagttccatgtcgcccacacagccgatatcgcacgaagaacaaccc
cggtatgaggatcctgacgctcctctggatttaagtttacatccagacgttgctgctcaa
ccagctccccaggctccataccagggataccaggagccgccggccccccaggctccatac
cagggataccaggagccgccgcccccccaggctccataccagggataccaggagccgccg
gcccacgggctccaatcatcttcatatccaggatatgcgggtccctggaccccaaggtct
caacatccatgttataggcacccctgggcaccatggtctcaagatcctgtgcatgggcac
acccagggtccatgggatcccagggcaccacatctcccacctcagtgggatggatctgca
ggacatggccaggatcaggtctcccagttcccacatctgcaatcggagacaggcccacca
cgtcttcaactttcattggtgccactggtctcatcctctgcaccatcatggtcatctccc
cagccccgagcccccatacgccccattccaacaagattcccccctccccctatgccgtta
caagatagcatggccgtggggtgtgactcatcaggtacagcatgcccaagcatgcccttt
gccagtgattacagtcaaggtgcatttaccccactggacattaatgccaccacgccaaaa
aggcctcgagtagaagaaagttctcacggacctgcccggtgttcccaagctactgctgaa
gcacaggagattctcagtgacaattctgagatctccgtgttcccaaaggacgcgaagcag
actgactacgatgcatccactgaaagtgagctagattaa

DBGET integrated database retrieval system