KEGG   Viruses: 4238562
Entry
4238562           CDS       T40000                                 

Symbol
TATV_DAH68_095
Name
(RefSeq) Taterapox virus; IMV membrane protein
  KO
K24608  Orthopoxvirus protein L5
Taxonomy
TAX:28871
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Orthopoxvirus
Organism
vg  Viruses (Taterapox virus)
SSDB
Motif
Pfam: Pox_L5
Other DBs
NCBI-GeneID: 4238562
NCBI-ProteinID: YP_717402
RS: NC_008291
UniProt: Q0NPB6
Position
NC_008291:79733..80119
AA seq 128 aa
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMPKRK
IPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPV
SLNDVLRR
NT seq 387 nt   +upstreamnt  +downstreamnt
atggagaatgttcctaatgtatactttaatcctgtgtttatagagcccacgtttaaacat
tctttattaagtgtttataaacacagattaatagttttatttgaagtattcgttgtattc
attctaatatatgtattttttagatctgaattaaatatgttcttcatgcctaaacgaaaa
atacccgatcctattgatagattacggcgtgctaatctagcgtgtgaagacgataaatta
atgatctatggattaccatggatgacaactcaaacatctgcattatcaataaatagtaaa
ccgatagtgtataaagattgtgcaaagcttttgcgatcaataaatggatcacaaccagta
tctcttaacgatgttcttcgcagatga

DBGET integrated database retrieval system