KEGG   Viruses: 4484285
Entry
4484285           CDS       T40000                                 
Symbol
ATV_gp07
Name
(RefSeq) Acidianus two-tailed virus; hypothetical protein
Taxonomy
TAX:315953
  Lineage
Viruses; dsDNA viruses; Bicaudaviridae; Bicaudavirus
Organism
vg  Viruses (Acidianus two-tailed virus)
SSDB
Motif
Pfam: F-112 PPV_E1_DBD
Other DBs
NCBI-GeneID: 4484285
NCBI-ProteinID: YP_319838
RS: NC_007409
UniProt: Q3V4T1
Position
NC_007409:complement(2227..2439)
AA seq 70 aa
MQSVNEVAQQLFSKLREKKEITAEDIIAIYNVTPSVAYAIFTVLKVMCQQHQGECQAIKR
GRKTVIVSKQ
NT seq 213 nt   +upstreamnt  +downstreamnt
gtgcaaagcgtaaatgaagttgcacagcaattattttccaagttaagggagaaaaaagag
attacagcggaggatataatagcaatctataacgtgaccccatcagtagcgtatgccatt
tttacagtattgaaggtaatgtgccaacaacatcagggtgaatgccaagctataaagagg
ggaagaaagaccgtcatcgtgagtaaacaataa

DBGET integrated database retrieval system