KEGG   Viruses: 5176209
Entry
5176209           CDS       T40000                                 
Symbol
HHV4tp2_gp28
Name
(RefSeq) Human herpesvirus 4 type 2; EBNA-3A
  KO
K21855  EBV nuclear antigen 3
Taxonomy
TAX:12509
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus; unclassified Roseolovirus
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB
Motif
Pfam: EBV-NA3
Other DBs
NCBI-GeneID: 5176209
NCBI-ProteinID: YP_001129463
RS: NC_009334
UniProt: Q69138
Position
NC_009334:join(80026..80361,80447..82888)
AA seq 925 aa
MDKDRPGLPAPDDNIEEVPSTSGVQERASEGDWENVLIEISDSSSEEEAEDAHLEPSQRG
KKRKRVDDDAGGSAPAQHVPPPQLDHPGREAILYRFPLDLRRFIQAIGAAATHPDTRAID
QFFGSQISNTDLYVMYAMAIRQAIRDRRRNPASRRSQVKWRMTTLAAGWPMGYQAYSSWM
YSYTDPQVTATIIHLQATLGCASGRRCHVTFSAGTFRPPRCSPGDRQWLYVQSRVGDLVQ
SSNPCYSIFFDYMAIHRSLTKIWDEVVTPDQRVTFMEFLGFLQRTELVYIKSFVSYALGT
TSIETPWMDENPSTETAQAWNAGLLRGRAYGQDLLRTEGEHGEGATCETREESEDTESDG
DDEELPRVVSRDGTKHRRPPIFLRRLHRLLLMRAGKGKERARETLAKAPRRTYGTPRPPV
QKPRPEVPQSYETATSHGSAQVPEPPPTHPLHQQHSMAPCMVAQNPRAPLGDQLPGVPKD
GRGACAPVPALAGPIVRPWESSLLQSPGRAFAPVSPQPMPVEPVPVPTVALERPVCPAPP
EIAMQGPGEPSGIKRTRERWRPAPWTPNPPRSPSQMSVRDRLARLRAEAQARQASVEVQP
TQLTQVSPQQPMERPLEPEQQMFPGSPFSQVADVARESGVPAMQPQYFDLPLTQPISQGA
PAAPLRASMGPVPPVPATQPQYFDIPLTEPINQGASAAHFLPQQPMEGPLVPERWMFQGA
TLSQSVRPGVAQSQYFDLPLTQPINHGAPAAHFLHQPPMEGPWVPEQWMFQGAPPSQGTD
VVQHQLDDLGYPLHDLNHPGVPVSPAVNQYHFSQAAFGLPIDEDESGERSDTSEPYEALD
LSIHGRPCPQAPEWPVQGEGGQDATEVLDLSIHGRPRPRTPEWPVQGESGQNVTDHEPRR
VVVSAIVHMCQDDEFPDLQDPPDEA
NT seq 2778 nt   +upstreamnt  +downstreamnt
atggacaaggacaggccgggtctcccggccccggatgacaacatagaagaagtaccatct
acctcgggtgttcaggaacgggcgtctgagggagattgggaaaatgtcctcatagagata
tcagatagcagctcagaagaggaagcagaagatgcccacctggagccatcccagaggggt
aaaaagagaaaacgggtcgatgatgatgccggtggttcagctccagcacaacacgtgccc
ccccctcagctggatcaccctggtcgagaagccattctctacaggtttccgctagattta
agaaggtttattcaagcaattggagccgcagctacgcaccccgacacgcgagccatagac
cagtttttcggatcccagatttcaaataccgacctgtacgtaatgtatgccatggccatt
cgacaggccattagagatcgtcggaggaatccagcttctcgtagaagtcaggtcaaatgg
agaatgaccaccctggccgctggttggcctatgggttaccaggcatacagtagctggatg
tacagctacaccgatccccaggtgactgccacgatcatacatctgcaggcgactcttggg
tgcgcaagtggccgtaggtgtcatgtgaccttttctgccggcacctttaggccgccgcga
tgtagtcccggggatcgccagtggttgtatgttcagagccgcgtgggtgaccttgtgcag
agttctaatccatgctacagtattttctttgactacatggccatacataggagcctcacg
aaaatctgggatgaagtggtaacacctgatcagcgtgttacatttatggaattcctgggc
tttttgcaacgcacggagttggtctacatcaagagctttgtcagctatgccttgggcacc
actagtatcgaaacaccgtggatggatgagaatcctagcacagagacggcacaggcttgg
aatgccggcttgctccgggggcgtgcgtacgggcaagacttgcttagaactgaaggagaa
catggcgaaggtgctacctgtgaaacacgggaagaaagtgaggacacagagagcgatggg
gatgatgaagaacttcctcgtgtagtgtccagggatggaactaagcacagacgaccccct
atatttttaagacgcctgcacaggttgctgttgatgagagcgggcaaaggaaaggaacgg
gccagggagacactggcgaaggcccctaggcgcacttatggcacacctaggccgccagtt
cagaaaccaagaccagaggtcccgcaaagctatgagacagctaccagtcacgggtcggcg
caagtcccagaacccccacccacccacccattacatcagcaacacagcatggccccgtgt
atggtagctcagaacccacgtgcacccttaggggaccaactcccaggtgttcctaaagat
ggacgaggggcgtgtgcaccggtacccgccctggccgggcctattgtccggccctgggag
tcatccctgttacagtctccgggaagggcctttgcacccgttagcccacaacccatgcca
gtagaacccgtccctgtccctactgtggcacttgagcgaccagtttgtcccgcacctcct
gagattgctatgcagggcccgggggaaccttctggcattaaacgcacacgggagcgttgg
aggcccgcaccgtggacgccaaacccaccccgctctcccagtcagatgtccgtgcgtgac
cgtctggctcgtttgcgtgctgaggcacaggcccgtcaggctagtgttgaggtgcagccc
acccagttgacccaagtatcccctcagcaaccaatggagaggccgttggaaccagagcag
cagatgttccctggttccccctttagccaggtcgctgatgttgcccgggaatctggggta
cctgcaatgcagcctcagtactttgacctccccttaactcaacccattagccagggggca
cccgcggccccgttgagggctagtatgggcccggtacctccggtaccggcaacacagcca
cagtattttgacatccccttaactgaacccattaaccagggggcatccgcggcccatttt
ctccctcagcaaccaatggaggggccgttggtacccgagcggtggatgttccaaggtgcc
accctgagccagagtgttaggccaggggtagcgcagtcacaatattttgacctcccctta
actcaacccattaaccatggggcacccgcagcccatttcctccatcagccaccaatggag
gggccgtgggtacccgagcagtggatgttccaaggtgccccccctagccaaggcactgac
gtggtccaacatcagctggatgatttggggtatccactccatgatctcaaccatcccggg
gttcccgtgtctcctgccgttaaccaatatcatttcagccaggctgcctttgggttacct
attgatgaggatgagagtggcgagaggtccgatacctccgagccgtatgaagctcttgat
ttgtcaatccatggcaggccctgccctcaggcccccgaatggcctgttcaaggggagggt
ggccaggatgccaccgaggttcttgatttgtcaatccatggcaggccccgccctcggacc
cccgagtggcctgttcaaggggagagtggccagaatgtcacagaccatgaacctagaagg
gtggtggtgtcagctattgttcacatgtgtcaggatgacgagtttccggatctacaagat
cctccagatgaggcctaa

DBGET integrated database retrieval system