KEGG   Viruses: 5176219
Entry
5176219           CDS       T40000                                 
Symbol
HHV4tp2_gp29
Name
(RefSeq) Human herpesvirus 4 type 2; EBNA-3B
  KO
K21856  EBV nuclear antigen 4
Taxonomy
TAX:12509
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus; unclassified Roseolovirus
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB
Motif
Pfam: EBV-NA3
Other DBs
NCBI-GeneID: 5176219
NCBI-ProteinID: YP_001129464
RS: NC_009334
Position
NC_009334:join(83074..83430,83509..86532)
AA seq 1126 aa
MKKAWLSRAQQADAGGASGSEDPPDYGDQGNVQQVGSDPISPAIGPFELSAASEDDPQSG
PVEENLDAAAREEEEPDEQEHNGGDDPLEVHTRQPRFVDVNPTQAPVIQLVHAVYDSMLQ
SDLRSLGSLFLEQNLNIEEFIWMCMTVRHRCQAIRQKPLPIDKQRRWKLLSPYRTWRMGY
RTQTLNVNSFETGGDKVHPLLVTATLGCEEGLRHAITYSAGIVQLPRMSDQNQKIETAFL
MARRARSLSAERYTLFFDLVSSGNTLYAIWIGLGTRNRVAFVEFVGWLCKKDHTHIREWF
RQCTGRPSPSKPWMRAHPVAVPYDDPLTSEETDLAYARGLAMSIEAARLPDDPIIVEDDD
ESEEIEDKCDKDEEESGTEDVTSIPQTLPHSPTVYGRPSVFYRKPDTKSTKKCRAIVTDL
SIIKVIEDEHRKKKTARTEQPRAKPDSPAPTVVLRRPPTQKVTGPAGSLSVQAQLEPWQP
LSWPHETRVILHGPPTQGDQAHGSMLDLLEKDDQHMEQQVMATLLPPEPHQPRSGRRAPC
VYTADLDIESDEPATSEPVLDQLLPAPGLGPLAIQPLTSPTTSQLRSSAPSHAQTPWPVT
HPSQTPGGPTTQSLAPETEAPRQWPMPLRPIPLHPLRMQPISFNPAVRPTPHQPPQVEPT
FYQSTWVKPPQQYQPQMGHIPYQPRPTGHSTMLRPQWAPTTMQPPPRAPTPMPPPQGPPT
AMQRPQGAPTPMPPPQGTPTAMQRPQGAPTPMPPPQGTPTAMQRPQGAPTPMPPPQGTPT
AIQRPQGAPTPMPPPQGTPTAMQRPQGAPTPMPPPQGTPTAMQRPQGAPTPMPPPQGPPT
AMQRPRGAPTPMPPPQGPPTAMQRPQGAPTPMPPPQGPPTAMQRPRGAPTPMPPPQGPPT
AMQRPQGAPTPMPPPQGPPTAMQRPRGAPTPMPPPQGPPTAMQLSPRALTGQKGPAKHIL
RQLLTGGVKSGRPSLKFKAALERQAAAGLRPSPGSGTGAKIVQAPVFYPPVLQPIQVMWQ
VGSSKAVAASTVTQAPTEYTGERRLGGPMSPTDIPPSKRVKKKAYPERKTPHGGPSHSST
VMWENVSQGQQQTLECGGTDKQERNMLGMGDIAVSSPSSSETSNDE
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgaagaaagcgtggctcagcagagcacagcaagccgatgccgggggggcatctggctcc
gaggacccaccagattatggagatcaaggtaatgtgcaacaggtgggatctgatcctatt
tcacctgcgattggcccctttgaactctctgcggccagtgaggatgatcctcaatctggg
ccagtggaagagaatttagatgccgctgcaagagaggaagaggaacctgatgagcaggag
cacaatggtggtgatgatcccttggaagtccatactcggcagcctagatttgtggatgtg
aacccaacgcaggctccagtgatccaactagtccatgctgtttatgattccatgttgcaa
tcggacctccggtctctaggcagtttattccttgagcaaaacctgaacatcgaagagttt
atatggatgtgcatgacagtgcgtcacagatgtcaggccatcagacaaaaaccattaccg
attgataagcagaggcggtggaagctcctgtcaccttacagaacctggcgtatgggttac
cgtacgcaaaccctcaatgtaaacagttttgagacagggggagataaagtccacccactc
cttgtgactgctacgctaggatgtgaagagggcctgcggcatgcaataacttacagtgct
ggcattgtacagctaccacgaatgtcagaccaaaaccaaaagatagaaacagccttcttg
atggcacgtcgtgctaggtcactttcggcagaaagatatactttgttctttgatttagta
tcctctggaaacaccctgtatgccatatggattgggctgggcacgagaaaccgagttgca
tttgtcgagtttgtaggatggctatgtaagaaggaccacactcatatacgtgaatggttc
cgccagtgcaccgggagaccctcaccatccaagccatggatgagagcgcatcccgtcgcc
gttccttatgacgatccattaacaagtgaggagactgacctggcctatgcccgtggactg
gccatgagtatcgaggctgctagactgccagatgatccaataattgttgaggatgacgat
gaaagtgaggaaattgaagataaatgtgataaggatgaagaggaaagtggaacggaagat
gttacaagcataccgcaaacactgccgcacagtccaacagtatacggcaggccctcggtg
ttttaccgaaagccagatactaaatcaaccaaaaaatgcagggccatagtgactgacctt
agtataatcaaggtcattgaagatgaacacagaaagaagaagacagccagaacagagcaa
ccaagagccaagcctgattcccctgcccccacagtggtccttcggcgaccacccacgcaa
aaggtgactggccctgccggttcactgagtgtccaggctcagctggagccatggcaacct
ttgtcctggccacatgagacaagagttatacttcacggaccacccacgcagggtgaccaa
gcacacggttccatgctagaccttcttgaaaaggacgaccagcacatggagcagcaggtt
atggcaaccctactgccaccagaaccacaccagccccggtctgggagaagagccccttgt
gtctacaccgctgacctagacatagaaagtgatgagcccgccacgtcagagccggttctt
gatcagctactgcccgccccaggacttggacctcttgcaattcaaccattaacgtccccc
accacgtctcaactccgcagttcagcaccgagccacgcacaaactccatggccggttacc
cacccaagtcagactccaggtggcccaacgacacagtccctggcaccggaaacagaagcc
ccgcgccagtggccaatgccactgcgacctatccctctgcaccccttgcggatgcagcca
atatcatttaatcctgcagtgagacccactccccatcagccacctcaggtggagcccact
ttctatcagtccacttgggtgaaaccccctcaacaataccagcctcagatggggcacatt
ccatatcagccccgaccaacgggtcactctactatgctccggccccagtgggcacccacc
accatgcagccaccaccaagggcgcccactcccatgccgccacctcaggggccacccacc
gctatgcagaggcctcagggggcgcccactcccatgccgccacctcaggggacacccacc
gccatgcagaggcctcagggtgcgcccactcccatgccgccacctcaggggacacccacc
gccatgcagaggcctcagggtgcgcccactcccatgccgccacctcaggggacacccacc
gccatacagaggcctcagggtgcgcccactcccatgccgccacctcaggggacacccacc
gccatgcagaggcctcagggggcgcccactcccatgccgccacctcaggggacacccacc
gccatgcagaggcctcagggggcgcccactcccatgccgccacctcaggggccacccacc
gccatgcagaggcctcggggggcgcccactcccatgccgccacctcaggggccacccacc
gccatgcagaggcctcagggggcgcccactcccatgccgccacctcaggggccacccacc
gccatgcagaggcctcggggggcgcccactcccatgccgccacctcaggggccacccacc
gccatgcagaggcctcagggggcgcccactcccatgccgccacctcaggggccacccacc
gccatgcagaggcctcggggggcgcccactcccatgccgccacctcaggggccacccacc
gccatgcagctgtcaccaagggcacttaccggccagaaggggccagcaaagcacattctg
cgccagttgttaacggggggcgtcaagagtgggagaccatcacttaagtttaaggctgcc
cttgagcgtcaagccgctgcgggcttgcgaccttcaccagggtctggaacgggtgccaag
attgtgcaggcacctgttttctatccacccgtcctacagcccatacaagttatgtggcaa
gtgggttcctcaaaggccgtggccgcctcaacggtgacacaggcacccacggaatatacc
ggggaaaggaggttaggggggcctatgtctcccactgatattccgccgtctaaacgggtg
aagaaaaaggcctatccagagcgcaagacgccgcatggggggccctcacactcttccacc
gttatgtgggagaatgtcagccagggacaacagcagactctggagtgcggaggaactgat
aaacaggaaaggaacatgttggggatgggggacattgcagtttcttccccttcctcttct
gaaacatcgaatgatgagtga

DBGET integrated database retrieval system