KEGG   Viruses: 7751243
Entry
7751243           CDS       T40000                                 
Symbol
HVRV_s7_gp1
Name
(RefSeq) Homalodisca vitripennis reovirus; minor core protein
Taxonomy
TAX:411854
  Lineage
Viruses; dsRNA viruses; Riboviria; Orthornavirae; Duplornaviricota; Resentoviricetes; Reovirales; Sedoreoviridae; Phytoreovirus
Organism
411854  Viruses (Homalodisca vitripennis reovirus)
SSDB
Motif
Pfam: Phytoreo_S7
Other DBs
NCBI-GeneID: 7751243
NCBI-ProteinID: YP_002790890
RS: NC_012541
UniProt: C1JAW4
Position
NC_012541:26..1549
AA seq 507 aa
MSAIVGVCLLSETTVLVRNLNDVVKGLYSRIRGNVTPPKESIEARVSGQTVKVQRTIPIN
TVFIEYLDQDYISANPTMSAMEIIGSSGNTAPKTTFQSLLPSLSALFGVAFIQGAFMHRV
ISTTGPTISFLVLVIGPPGNFTRKPSVAAASSVVQVESTSDIDLNDTVKINALMLQNTKL
VSASAIHATSLGEVSEKCDSLDTMIIMKALTYFKRYAYEQSLGTMDNATRVYLNLPIDEI
FSGRTASGEQLQNKIATFKESRGHLAGVVLPDGHGKSTLVSDYPEIFTLLKDNNEATDPS
DNGEIEANKSKGKYEGKIVLASSVKELFDNGIRVLGVLKLESEAQVEDEINKDQVLKNKK
DKIMEGWKNTSGPNVVTSKNLPLLHDKVMDIVTTHTKGIKTNRSGKPIEIKTDPKLRPET
RISIYFKNGFPIARYSTNKLSKHGIDVVEAKDLNEDTIIVSNKPKNTPRRVPQNVKTKLE
SMRSNLKVDVDTDNLTEEEFIAKIKAL
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtctgcaattgttggagtatgcttgctaagtgaaacgacagtcctagtgagaaattta
aatgatgtagttaaaggtttgtattcacggattcgagggaatgtgacaccacctaaagaa
tctattgaagccagagtttctggacaaaccgttaaagtgcaaagaacaataccaataaat
acagtatttatagaatatttagatcaagattatataagcgcaaacccaacaatgagcgct
atggagataataggtagctcaggtaatacggcaccgaaaacgacatttcaaagcctgtta
ccatcactatctgcattatttggagtggcgttcattcaaggcgcatttatgcatagagtt
atatctacaacaggtccaacgatatcatttttggtattagtaataggtccaccaggaaat
ttcacaagaaaaccaagcgtagctgcagcatcgtcagtagttcaagtggaatcgacatca
gacattgatctgaacgatacagtgaaaataaatgctctaatgctgcaaaatacaaaactt
gtatcagcatcggcaattcacgcaacgtcgctgggtgaagtgtcagaaaaatgcgatagt
ttggataccatgataatcatgaaagcattaacatattttaaacggtatgcatatgagcaa
agtcttgggacgatggataatgcaacgcgtgtgtatctaaatctgccaattgacgagata
ttctcagggagaacggctagtggagaacaacttcaaaacaaaatagcaacattcaaagaa
tctcgtggtcacttagctggggtagtgttaccagacggacatggtaaatcaactttggta
tctgattatccagaaatatttacgctgttaaaagacaataatgaagctactgacccatcg
gataatggggaaattgaggctaataaatcaaagggtaagtatgaaggtaaaatagtgcta
gctagtagtgtcaaagaattgtttgacaatgggattcgcgtgttaggagtcctaaaactt
gaatctgaagctcaagtggaggatgagataaataaagatcaagtacttaaaaataaaaaa
gataagattatggagggatggaaaaatacatccggtccaaatgttgtaactagtaagaac
ttgcctctattacatgacaaagtgatggatatagtcacaacgcatactaaaggaattaag
acaaacaggtcagggaagcctattgagataaaaactgatcccaagctgagaccagagaca
agaatcagtatttatttcaaaaatggttttccaattgctagatattcaactaataagcta
tcaaagcacggtatagatgtagttgaggcaaaggatctaaatgaggacacaattatagtg
tcgaataaacctaagaatactccaaggagagtacctcaaaacgttaaaactaaactcgaa
tcaatgcgatcgaatttgaaggttgatgtcgatactgacaacttaactgaggaggaattc
atcgccaagattaaagcattatga

DBGET integrated database retrieval system