KEGG   Viruses: 932477
Entry
932477            CDS       T40000                                 

Symbol
SPV061, SWPVgp061
Name
(RefSeq) Swinepox virus; SPV061 hypothetical protein
Taxonomy
TAX:10276
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Suipoxvirus
Organism
vg  Viruses (Swinepox virus)
SSDB
Motif
Pfam: Pox_L5
Other DBs
NCBI-GeneID: 932477
NCBI-ProteinID: NP_570221
RS: NC_003389
UniProt: Q8V3N3
Position
NC_003389:54824..55213
AA seq 129 aa
MESRNINFTPVFIEPTLKHSLLNIYKYNYIIIFEIIIVILLVYIFFKSEIIMLISYKDDI
SINPIDNFSKSWLSCDGNKLVINNLPNTNGTKTALAINRQDITYKDCNFLLQSINGSSKI
SLNDVLRRQ
NT seq 390 nt   +upstreamnt  +downstreamnt
atggagtctaggaatataaactttacacctgtatttatagaacccacgttgaaacactcg
ttactgaatatatataagtacaattatattattattttcgagataataattgttatctta
ctagtttatatattttttaaatctgaaattattatgttaataagttacaaagatgatata
tctataaatcctattgataatttttctaaatcgtggctatcatgcgatggtaataaatta
gttattaataatttgcctaatactaacggtacaaagacagctcttgctataaatagacag
gatataacatataaggattgtaactttcttttacaatcaataaatggatcatcgaaaata
tctcttaacgatgttcttcgaagacaatga

DBGET integrated database retrieval system