KEGG   Viruses: 944566
Entry
944566            CDS       T40000                                 

Gene name
X, HBVgp3
Definition
(RefSeq) Hepatitis B virus; X protein
  KO
K21854  HBV protein X
Taxonomy
TAX:10407 [GN:T40004]
  Lineage
Viruses; dsDNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Blubervirales; Hepadnaviridae; Orthohepadnavirus
Organism
vg  Viruses (Hepatitis B virus)
SSDB
Motif
Pfam: X
Other DBs
NCBI-GeneID: 944566
NCBI-ProteinID: YP_009173867
RS: NC_003977
UniProt: Q2F514
Structure
PDB: 
5B1Z

Position
NC_003977:1376..1840
AA seq 154 aa
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPV
CAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDW
EELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctgctaggctgtgctgccaactggatcctgcgcgggacgtcctttgtttacgtccc
gtcggcgctgaatcctgcggacgacccttctcggggtcgcttgggactctctcgtcccct
tctccgtctgccgttccgaccgaccacggggcgcacctctctttacgcggactccccgtc
tgtgccttctcatctgccggaccgtgtgcacttcgcttcacctctgcacgtcgcatggag
accaccgtgaacgcccaccaaatattgcccaaggtcttacataagaggactcttggactc
tcagcaatgtcaacgaccgaccttgaggcatacttcaaagactgtttgtttaaagactgg
gaggagttgggggaggagattaggttaaaggtctttgtactaggaggctgtaggcataaa
ttggtctgcgcaccagcaccatgcaactttttcacctctgcctaa

DBGET integrated database retrieval system