KEGG   Viruses: 944671
Entry
944671            CDS       T40000                                 

Symbol
SPPV_60
Name
(RefSeq) Sheeppox virus; hypothetical protein
Taxonomy
TAX:10266
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Capripoxvirus
Organism
vg  Viruses (Sheeppox virus)
SSDB
Motif
Pfam: Pox_L5
Other DBs
NCBI-GeneID: 944671
NCBI-ProteinID: NP_659636
RS: NC_004002
UniProt: A0A2H4EUE0 A0A3F2YKM0
Position
NC_004002:55512..55910
AA seq 132 aa
MEKNNSKNIYFTPVFIEPTIKHSLLQSYKYTYIIIFEIITVMVLLFLFFKSEIKMLFNFK
QQKVISPIDKFSKTTLYCKENKLFISGLPNTMYSKEALSLNRQPITYKYCNDLLQSINGS
QQVSINDILRKR
NT seq 399 nt   +upstreamnt  +downstreamnt
atggagaaaaataactcaaaaaacatttattttactcctgtatttatagaacctactata
aaacattcccttttgcaatcttacaaatatacatatatcataatatttgaaattataaca
gtgatggtattattatttttattttttaagtcagaaatcaagatgttgtttaattttaaa
caacaaaaagttatcagtccgatagataaattttcaaaaaccactttatactgtaaagaa
aataagctttttattagtgggttacctaatactatgtactcaaaggaagcactatcatta
aatagacaaccgataacatataaatattgtaatgatcttttacaatcaataaatggatca
cagcaagtatctattaacgatattcttagaaaacgatga

DBGET integrated database retrieval system