KEGG   Viruses: 956495
Entry
956495            CDS       T40000                                 
Symbol
RDVs7gp1
Name
(RefSeq) Rice dwarf virus; minor core protein
Taxonomy
TAX:10991 [GN:T40204]
  Lineage
Viruses; dsRNA viruses; Riboviria; Orthornavirae; Duplornaviricota; Resentoviricetes; Reovirales; Sedoreoviridae; Phytoreovirus
Organism
10991  Viruses (Rice dwarf virus)
SSDB
Motif
Pfam: Phytoreo_S7
Other DBs
NCBI-GeneID: 956495
NCBI-ProteinID: NP_620530
RS: NC_003760
UniProt: Q85435
Position
NC_003760:18..1538
AA seq 506 aa
MSAIVGLCLLSEKVVLSRSLTDEVSKLYKLNRGNVKEPRKYATERMSTQSKPVALQVPVS
TIILDYKDEDFIKQNPTYSAMDIIGSPSNTAPQTAFQSIMPSLSALFNTPFIQGAFRHRV
ISSMGPEISYLVMVIGPPSGFMDTPMYRTVNHLSILMSNADVDLIDIIAINSTMAKSTKL
VFASTFQAMLVNDVYDRCMVLVGIFLSQALPFFRNYVNVQSKGSLPPAVAACLNTPIKEL
FSMGSGKREPLALEFRKDNEGQCLGIVLPKGHEGDTLSSRYPAVFINESEPFSDEERSEL
SKLKRTDPDAYEKLYSETISKHVSDGSYGNRVIISHKMSRLSNGGVKIIGRFKISDFNTV
KKNLSSRPGEVDSAKEQWEALSGNGLVTDNNTSMLHDKILDTITSNKPGVVLRDGNKKSD
NIVVCFKNGFPNKKHSLLQLTKNGISVVSLDELTDAGILVESTGPDRVRRSPKALANKLS
SFKGRKVTLDVDNMSTEALIQKLSTL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgtctgcgattgtaggcctctgcctcctatcggaaaaagtcgttttatctagaagcctg
acagacgaggtttctaaactgtataaattgaatcggggcaacgtcaaagaaccccgaaag
tatgctactgaacgtatgtctacacagtccaaacctgtggcgttgcaggttcctgtttcg
acaataattctagactataaggatgaggattttattaaacaaaacccaacttatagtgcc
atggatataattggaagccctagtaatacggctccgcaaacggcgtttcaaagtataatg
ccgtctctatctgcgctatttaatacccctttcatccagggggcttttcggcaccgggtc
atatcaagtatgggacctgaaatttcatacttagttatggtcatcggaccaccaagtggt
tttatggatacgccaatgtatcgtacagtcaatcatctgtccatactgatgtcaaatgct
gatgttgacttgattgatattatcgctattaattcgacgatggctaaaagcacgaagttg
gtgtttgcttcaacttttcaggccatgttggttaatgacgtttatgatagatgcatggtt
ttggttgggatttttttatctcaggctcttccattcttcagaaattacgtcaatgtacaa
tcgaagggttctctccctccggctgtggccgcttgcttaaacactcccattaaggaatta
ttctcgatgggctctggtaaacgtgagccgttggcgctggaatttagaaaggataatgag
gggcaatgccttggcattgttcttcccaaagggcatgagggagataccctatcatcccgc
tatcctgctgtttttattaatgaaagtgagcccttctctgatgaagagcgttctgagctg
tccaaactcaaacgaacagacccggacgcgtatgagaagctctattctgaaacgatctct
aagcacgtctctgacggatcgtatgggaatagggtaattatttctcataaaatgtcaaga
ttatcaaatgggggagtcaagataattggaagattcaagatatctgacttcaatactgtg
aagaagaatttatcctcgcgacctggcgaggtagattctgcaaaggagcaatgggaagct
ttgtccggtaacggcttggtgacggacaacaacacttccatgcttcatgacaaaatatta
gacaccatcacctctaataagccaggggtggtacttagagatggtaataagaaatctgat
aatatagtggtttgctttaaaaatggcttcccaaacaagaagcattctttactgcagttg
actaaaaatggaatatcagttgtcagtttggatgaattgactgatgctggtatcctcgtg
gagtctacaggaccagatagggttcgtagatccccgaaagctttggcaaataagctctcc
tcctttaagggacggaaagtaactcttgatgttgacaatatgtcaacggaagcgctcata
caaaagctgtcaactttatga

DBGET integrated database retrieval system