KEGG   Vibrio campbellii: VIBHAR_00597
Entry
VIBHAR_00597      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
vha  Vibrio campbellii
Pathway
vha00010  Glycolysis / Gluconeogenesis
vha00020  Citrate cycle (TCA cycle)
vha00620  Pyruvate metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha01200  Carbon metabolism
Module
vha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VIBHAR_00597
   00020 Citrate cycle (TCA cycle)
    VIBHAR_00597
   00620 Pyruvate metabolism
    VIBHAR_00597
Enzymes [BR:vha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     VIBHAR_00597
SSDB
Motif
Pfam: PEPCK_ATP AAA_16 AAA_33 AAA_25
Other DBs
NCBI-ProteinID: ABU69599
UniProt: A7MZB2
Position
I:complement(581920..583548)
AA seq 542 aa
MTVMEHTKAATIDLTKHGLHNVKEVVRNPSYEMLFEEETRADLTGYERGVVTELGAVAVD
TGIFTGRSPKDKYIVKDATTEEHMWWTSDAVKNDNKPINKEVWDDLKELVTNQLSGKRLF
VIDGYCGANPDTRLSIRVITEVAWQAHFVKNMFIRPTEEELATFEPDFVVMNGAKCTNDK
WEEQGLNSENFTVFNLTERTQLIGGTWYGGEMKKGMFAMMNYFLPLKDIASMHCSANMGE
EGDVAIFFGLSGTGKTTLSTDPKRALIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPD
IYNAIRRDALLENVTVRSDGSIDFDDGSKTENTRVSYPLYHIDNIVKPVSKGGHANKVIF
LSADAFGVLPPVSKLTPEQTKYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPT
KYAEVLVKRMEAAGAEAYLVNTGWNGSGKRISIQDTRGIIDAILDGSIEDAKTKHIPIFN
LEVPTSLPGVDPSILDPRDTYVDPLQWESKAKDLAERFINNFDKYTDNAEGKSLVAAGPQ
LD
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgaccgttatggaacatacaaaggctgcaacaattgatctgaccaaacacggactgcat
aacgttaaagaggttgttcgcaacccaagctacgaaatgctgtttgaggaagagacccgt
gctgacctaacaggttatgaacgtggtgtggttacagaactcggcgcggttgccgtagac
actggtatctttactggtcgctcaccaaaagataagtacattgtaaaagatgcaacgaca
gaagagcacatgtggtggacttctgacgcagtgaaaaacgacaacaaaccaatcaacaaa
gaagtatgggacgacctaaaagagctagtgaccaaccagctttcaggtaagcgtctattt
gtgattgacggttattgtggtgcaaacccagacactcgtttgagcattcgagtgatcacc
gaagtagcgtggcaggcgcacttcgtgaaaaacatgttcatccgcccaacagaagaagag
ttggcgacgtttgaacctgacttcgtggtaatgaacggcgcgaagtgcacgaacgacaag
tgggaagaacagggactgaactctgaaaactttactgtgttcaacctaacagagcgcact
cagttgatcggcggtacttggtacggcggcgaaatgaagaaaggcatgttcgcaatgatg
aactacttccttccgctaaaagacatcgcatcaatgcactgtagtgcaaacatgggtgaa
gaaggcgatgtcgcgatcttcttcggtctctctggcacaggtaaaactaccctatctacc
gatcctaaacgtgcactgattggtgatgacgagcacggctgggacgacgacggcgtattc
aacttcgaaggcggctgttacgctaagaccatcaaactatcgaaagaagccgagcctgat
atctacaacgcaatccgccgcgatgcactattagagaacgtgacggttcgtagcgatggt
tctatcgactttgatgatggctctaagacagagaatacccgcgtgtcttacccactgtat
cacatcgacaacatcgtgaagccagtatcaaaaggcggtcacgcaaacaaagtgatcttc
ctatcggctgatgcgttcggcgtgttacctccggtttcaaaactgacgcctgagcaaact
aaataccacttcctgtctggcttcaccgctaagctagcgggtacagagcgtggcatcact
gagccgacaccaaccttctcggcgtgttttggtgcagcgttcctaaccctacacccaact
aagtacgctgaagtgctagtgaaacgtatggaagcagcaggtgcagaagcttacttagtg
aacacgggctggaatggtagcggcaaacgtatctctatccaagatacacgcggcatcatt
gatgcaatccttgatggctctattgaagatgcgaaaaccaaacacattccaatcttcaac
ctagaagttccaacttcactgccaggcgtcgatccaagcatccttgacccacgtgatacc
tacgttgacccactacaatgggaaagcaaagcgaaagacttggcagagcgcttcatcaac
aactttgataagtacactgacaacgcagaaggtaaatcactagtggcagcaggtcctcag
ctggattaa

DBGET integrated database retrieval system