KEGG   Vibrio campbellii: VIBHAR_01398
Entry
VIBHAR_01398      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K02361  isochorismate synthase [EC:5.4.4.2]
Organism
vha  Vibrio campbellii
Pathway
vha00130  Ubiquinone and other terpenoid-quinone biosynthesis
vha01053  Biosynthesis of siderophore group nonribosomal peptides
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    VIBHAR_01398
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    VIBHAR_01398
Enzymes [BR:vha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     VIBHAR_01398
SSDB
Motif
Pfam: Chorismate_bind
Other DBs
NCBI-ProteinID: ABU70374
UniProt: A7MT02
Position
I:1411351..1412571
AA seq 406 aa
MIMLRNSMGSSTMLTEFLNAHTDDASFFFSSPTVTLLTQGITAEFSQQVKFSELDTHISQ
LLESAKDAGNQNPIAVGVIPFSEHNPVHFIVPDRLITTSPIRPDKVSDVDGVADCPPSSI
QPIPTPEEYMRSVELAATSCCREDIDLDKVVLSRTMQVDTEEEIDRARLLKTLLKQNPGG
YTFSTRIGGSQSDAYLMGSSPELLVSRKGPHVCSNPLAGSRRRSDNECINQQQGELMMES
AKDLHEHAVVVDAVEKALQPWCHNLYVPMVPSVIETKAMLHLSTRIEGTVSDANTSVLKL
ASALHPTPAVCGYPTTQAYDFISHVEPFDRGYFTGLVGWVDARGNGEWVVVIRCAEVEKK
RLKVYAGAGIVAGSEPQSELEETGNKMRTVLNALGIEIRENMEVVQ
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgattatgcttcgtaactcaatgggaagtagcactatgctcaccgagtttcttaacgct
catacggatgatgcttcgttcttttttagctcaccgacggtgaccttacttacccaaggc
attaccgcagaattttcccaacaggtgaaattctccgagttagatactcacatcagtcaa
ttacttgaatcggcaaaggatgcgggaaaccaaaaccccattgcggtgggagtgattccg
ttctctgaacacaacccggtgcactttatcgtcccagaccgtcttatcacgacgtcacca
atcagaccggataaagtttctgatgtggatggggttgctgattgtccaccttcatcgatc
caaccgattcctactcctgaagagtacatgcgcagtgtcgagttggcggcgacaagctgc
tgtcgagaggacattgatctggataaagtggtgttatcacgcaccatgcaggtcgatacg
gaagaggaaattgaccgtgcacgcctcttgaaaaccttactcaaacaaaacccaggtggc
tacacgttttctacccgtattggtggcagtcaatctgacgcgtatttaatgggctcgagc
cctgaattgcttgtatcacgcaaaggcccgcacgtttgttccaaccctctggcgggttct
cgccgacgcagtgacaacgaatgcattaaccaacagcaaggtgagctgatgatggagagt
gcaaaagatctccatgagcatgccgtggtggtggatgcagttgaaaaagcgctgcagcct
tggtgccataacctgtatgtgccgatggtgccatcggtgatagaaaccaaagccatgctt
cacctctcgactcgcatcgagggcacggtatcggatgcaaacacgagtgtgttgaagtta
gcaagtgcactgcacccaacgccagccgtatgcggttatccgacgacgcaagcttacgat
tttattagccatgttgaaccttttgaccgcggttactttaccggtcttgttggttgggtt
gatgctcgtggcaatggtgaatgggtggtcgtgattcgttgtgcggaggtcgagaaaaaa
cgcctcaaagtatacgcgggcgctgggattgtggcaggctctgagccacaaagtgagctg
gaagaaaccggtaacaagatgcgcactgtactcaatgcgttgggcatcgagatccgtgaa
aacatggaggtggtgcaatga

KEGG   Vibrio campbellii: VIBHAR_01428
Entry
VIBHAR_01428      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K02552  menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
vha  Vibrio campbellii
Pathway
vha00130  Ubiquinone and other terpenoid-quinone biosynthesis
vha01053  Biosynthesis of siderophore group nonribosomal peptides
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01240  Biosynthesis of cofactors
Module
vha_M00116  Menaquinone biosynthesis, chorismate (+ polyprenyl-PP) => menaquinol
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    VIBHAR_01428
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    VIBHAR_01428
Enzymes [BR:vha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     VIBHAR_01428
SSDB
Motif
Pfam: Chorismate_bind
Other DBs
NCBI-ProteinID: ABU70403
UniProt: A7MZR9
Position
I:1446068..1447375
AA seq 435 aa
MSQFHQAVKRIIERVQQTEGDQTRLVEPLSEKPNFAFIDWLEAQPLFPKFYWQSRDTREE
VVALGQLHSFVEPGPAYMILGEGQRVWGGRSFDGQHEKNRRCMPSFFFLPQIELIRFDQQ
WSLAVNISEDKTRTLAGLKKLVCGVHSLAPISSHIRSIDHAPTQPEWNALVEKVLTGIDN
DEFKKVVLARKSTVMLDSTLSAAQLLKASYLNNHHSFHFLLSLDSKHSFMGSTPERLYSR
VGHELHTEALAGTIGRGDNPTQDMELANWLSQDSKNLNENQYVVDDIIDRLTPHSERVEV
ENEPRLVRLRKVQHLKRSINADLKAGINGVQLLSALQPTAAVAGLPRKASMQFILDNEPF
ARGWYAGSMGYISHERAEFCVAIRSALVLSDQVQLFAGAGIVPGSIAEHEWAELDKKMST
LLSLISDHPPLGVAS
NT seq 1308 nt   +upstreamnt  +downstreamnt
ttgtcacagttccatcaagccgtaaagagaattatcgagcgagttcagcaaacggaaggc
gatcaaacacgtttagtcgagccactcagcgagaaacccaatttcgcgtttattgactgg
cttgaagcacaaccactttttcccaagttttactggcagtcccgtgatactcgtgaagaa
gttgttgccctgggtcagctccattcatttgttgagcccggcccagcttatatgatcctt
ggcgaaggccaacgcgtgtggggtggtcgctctttcgatggtcagcacgagaagaatcgt
cgctgcatgccttctttcttttttctaccgcaaatcgagctgattcgatttgatcagcaa
tggtcactcgcggtgaatatctcagaagataaaacacgtacattagcaggcttgaaaaag
ttggtatgtggcgtgcatagtcttgcgccaatttcatcccatattcgctcaattgatcat
gcgccaacacagcctgaatggaacgcgttggtcgaaaaggtgctcacaggcatcgacaac
gatgagtttaaaaaagtggttctggctcgcaaatcgacagttatgttggattcaacactt
tctgctgcgcagcttcttaaagcgagctacctaaataaccatcacagctttcactttttg
ctgagtttagacagcaagcacagctttatgggctcgacgccagagcgactttactcgcga
gtggggcatgagctgcacacggaagcgttggctggcacgatcggccgcggtgacaatccg
acgcaagacatggagctggcgaactggttgtcgcaagattctaagaacctcaacgaaaac
caatatgtggtggatgacatcattgatcggttaacaccgcattcggagcgtgttgaggta
gaaaatgagcctcgattggttcgtctgagaaaggtccaacatcttaagcgtagtattaat
gcggatctgaaagcgggcatcaacggtgttcaattgctttcagctttacagccaaccgcc
gccgtggccggtttaccgcgcaaagcgtcgatgcaatttatattggataacgagccgttt
gcacgcggctggtatgcaggctcgatgggatatattagccatgagcgtgcagagttttgc
gtcgcaataagaagtgcgttggttttgagtgaccaagtacaactgtttgctggcgcgggt
attgttcctggctccattgcagaacacgaatgggccgagttagataaaaaaatgtcgacg
ttactttctcttatttcagaccacccgccgcttggggttgcatcatga

DBGET integrated database retrieval system