KEGG   Vibrio campbellii: VIBHAR_01399
Entry
VIBHAR_01399      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
vha  Vibrio campbellii
Pathway
vha01053  Biosynthesis of siderophore group nonribosomal peptides
vha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    VIBHAR_01399
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:vha01008]
    VIBHAR_01399
Enzymes [BR:vha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     VIBHAR_01399
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     VIBHAR_01399
Polyketide biosynthesis proteins [BR:vha01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    VIBHAR_01399
   Bacillibactin synthetase
    VIBHAR_01399
  Nonlinear NRPS
   Vibriobactin synthetase
    VIBHAR_01399
   Myxochelin synthetase
    VIBHAR_01399
SSDB
Motif
Pfam: AMP-binding AMP-binding_C GH3
Other DBs
NCBI-ProteinID: ABU70375
UniProt: A7MT04
Position
I:1412568..1414187
AA seq 539 aa
MSHESMQASGFTPWPEARAEQYRQAGYWTDQTIPQMLQASAIRLPQQLALVDGEREWTYQ
SLAQQVDQLAAGFQTKLSLKPGDKAVLHLPNIGEFYLSLFALLKIGVQPVLSLPAHRYSE
IRYFCHFTEAKVLITAPQRGVNTADIAQQVAAELPSLTSIVWAGEVSEMPTGSLTLDSLY
LNDAELHEEQGEGFAFFQLSGGTTGTPKLIPRTHSDYLYSVRASNEVCQFSDRTRYICVL
PAAHNFPLSSPGALGCFMAGGTVVLTPDASPQTAFSLIEKYQITVAALVPPLALLWLDEA
ARTEHDITSLEVLQVGGARFSEEAAKRVRPELGCTLQQVFGMAEGLVNYTRLDDPESEII
STQGRPMSSADELLVLDEMGNPVEQGTEGILFVRGPYTIQGYYRAPEHNQRSFTQQGYYR
TGDIVVLTEAGNLQVVGRDKDQINRGGEKIAAEEVENHLLAHDSVHDAAVIAIPDDYLGE
RSCAALVCPEQNPRVIEIKRFLRDRGLADFKIPDRVIFVDVLPKTPVGKINKNKLLELV
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgagtcacgagtctatgcaagcatccggttttaccccatggccagaagcgcgagcagaa
caatatcgccaagctggttactggacagatcaaacgatcccacaaatgttacaagccagc
gctattcgactgccacagcaattggcattggtagatggcgagcgcgagtggacgtatcaa
tctttggcgcaacaggtcgaccaactggcggcaggtttccaaaccaagctgagtctcaaa
ccaggagacaaagcggtgttgcatctaccgaacattggggagttttatcttagccttttc
gctctactcaaaattggcgtgcagcccgtactgtctttgccagcgcaccgttattcggag
attcgatacttttgtcattttaccgaggcaaaagtattaattactgcaccgcagcgaggt
gtgaacacggctgatatcgcgcagcaagttgcggctgaattgccgagtcttaccagcatt
gtttgggcgggtgaagtgagcgaaatgcctactggtagcctaactctcgatagtctttat
ttaaacgatgccgaactgcatgaagaacagggagagggcttcgcgttcttccaactttct
ggtggaactacgggcacgccaaaactgatcccgcgcactcatagcgactatctctatagc
gttcgtgccagcaatgaagtttgccagttctcagatcgaactcgttacatttgtgtgttg
cctgcggcgcataactttccgcttagttcgcctggtgcattaggctgttttatggctggt
ggcaccgtggtgttaacaccagacgccagccctcagacggcgttttctttgattgagaaa
taccaaattaccgtggcggctttggttccgccattagcactcttatggctggatgaagca
gcgcgaacagaacatgacattacttcccttgaagtgctgcaagtgggtggtgctcgtttt
agtgaagaagccgcaaagcgagtacgaccagagttgggctgtaccttgcagcaggtgttc
ggcatggcagaggggctcgtaaactacacccgtttggatgaccccgagtctgaaatcatt
tctacccaaggtcggccgatgtcgtctgcggacgagttgttggttcttgatgaaatgggc
aaccccgttgagcaaggaacagaggggattttgttcgtgcgtggcccttacactattcaa
ggttactaccgtgcgccagagcataatcagcgttcttttactcagcaagggtactaccgc
acgggcgatattgtcgttttgaccgaagcgggcaacttacaggtggtagggcgcgataaa
gatcagatcaaccgtggtggagagaaaatcgctgcggaggaggtcgagaaccatctgctt
gcccatgactcggtgcacgatgctgccgtaattgccattccggatgactacttaggtgag
cgcagttgcgcagctttggtttgcccagaacagaaccctagagtgattgaaataaaacgc
tttttaagagatcgcggcttagcggacttcaagatccctgatcgtgttatttttgttgat
gtactgccgaaaactcccgtcggaaaaataaataaaaacaagctattagaactcgtttaa

KEGG   Vibrio campbellii: VIBHAR_01400
Entry
VIBHAR_01400      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01252  bifunctional isochorismate lyase / aryl carrier protein [EC:3.3.2.1 6.3.2.14]
Organism
vha  Vibrio campbellii
Pathway
vha01053  Biosynthesis of siderophore group nonribosomal peptides
vha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    VIBHAR_01400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:vha01008]
    VIBHAR_01400
Enzymes [BR:vha01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.1  isochorismatase
     VIBHAR_01400
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     VIBHAR_01400
Polyketide biosynthesis proteins [BR:vha01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    VIBHAR_01400
   Bacillibactin synthetase
    VIBHAR_01400
  Nonlinear NRPS
   Vibriobactin synthetase
    VIBHAR_01400
   Myxochelin synthetase
    VIBHAR_01400
SSDB
Motif
Pfam: Isochorismatase PP-binding fvmX3
Other DBs
NCBI-ProteinID: ABU70376
UniProt: A7MT05
Position
I:1414252..1415142
AA seq 296 aa
MAIPSLSGYPLPKAIPENRVNWSVDPQRAVLLIHDMQQYFLNFYDVDSELIQTLTRNIQA
IKQTCIDAGIPAVYTAQPGDQKQEDRALLTDFWGPGLKADESITRIFPALAPTDQDIVYT
KWRYSAFQRTPLKSMMDETGRDQLIIVGVYAHIGCLQTAAEAFMTDIQAFMVSDAVADFS
SDDHDMALNYVAGRCGYVLDKQQLLSQINRADELVGGDFSIPQSQPHLTQQLAALLEVPV
DEMTPEDSLLDFGLDSVRMMSLVSDWQQAGLDVSFMELAANPSLQDWWQLIEKKRT
NT seq 891 nt   +upstreamnt  +downstreamnt
atggccattccctctctctctggttacccattgcccaaggcgataccagaaaaccgtgtt
aactggtctgtagacccccagcgtgccgtgttacttattcacgacatgcagcagtacttc
ctcaatttctatgatgtcgacagcgagttgattcaaaccctgacgcgtaatattcaggcg
atcaagcaaacctgtattgatgcagggatccccgcggtttataccgcgcaacctggtgac
caaaagcaagaagatcgcgcattgctgacggatttttggggaccaggtttaaaagccgac
gaaagcattactcgcatttttcctgcgttagcgcctaccgatcaagatattgtttacacc
aaatggcgttacagcgcattccagcgtacgccgcttaaatccatgatggatgaaacggga
cgcgatcagttgatcatcgttggtgtttacgctcacatcggttgtttgcaaactgcggca
gaagccttcatgaccgatattcaagcctttatggtgtctgatgcggtggcggacttttct
tctgatgatcatgacatggcgctcaactacgttgctggccgctgtggttatgttctggat
aaacagcagctcctgtctcagataaaccgtgccgatgaactggtcggtggtgatttctct
attcctcaatctcagccccacttaactcagcaattggctgctttgctagaagtgccagtc
gatgaaatgacaccagaagatagcctattggatttcggtttggactccgtgcgcatgatg
tcactggtgagtgattggcaacaagcgggacttgatgtgagttttatggaactggctgcc
aaccccagcttgcaagattggtggcaactgatcgagaagaaacggacttag

KEGG   Vibrio campbellii: VIBHAR_01401
Entry
VIBHAR_01401      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K02364  enterobactin synthetase component F [EC:6.3.2.14]
Organism
vha  Vibrio campbellii
Pathway
vha01053  Biosynthesis of siderophore group nonribosomal peptides
vha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    VIBHAR_01401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:vha01008]
    VIBHAR_01401
Enzymes [BR:vha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     VIBHAR_01401
Polyketide biosynthesis proteins [BR:vha01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    VIBHAR_01401
SSDB
Motif
Pfam: AMP-binding Condensation Thioesterase AMP-binding_C PP-binding Abhydrolase_6 Abhydrolase_1 Hydrolase_4
Other DBs
NCBI-ProteinID: ABU70377
UniProt: A7MT06
Position
I:1415170..1419123
AA seq 1317 aa
MNMYDLPYTAEQLLPLTDAQAGIWFAQLRDPENPIYKTGEYLVIDGKVDEPCFVEAVKTA
IDEVDSLHAKFVTTTEGPRMVIDRQNWQVERIDFSQQDAPLDAAVDWMKSELKQPVDLEQ
GPLFVMALLKLSEDQFVWFLSLHHIAIDGYSMSLVAGRVAHIYGQLAQGKPFDKIEFVDQ
QALLKEDDDYKASEKYQKDRAFYLQRYADHSDTVNLAGKPTVTSDRFLRLKGAMEVDDFQ
RMESLAKQCRTHWYSVLIASIAAYVHRMTRSNEVVLGVPLMGRLGSVAIQTPAMRVNILP
VRVSFEQGLDIKMLVKQVNQEFSSVRRHQSYRYEELHRELNLVKDNRNLFGPLVNIMPFE
YEHKFGELNSKAHNLSAGPVDDISFYCYELDGQLHIDMDANPELYSEKDIHEHQQRLFHF
MSDFFAIAQAQDPALCQVSDINILLAGEREKVIETWNDTDHEVPETTLAALLARQRILTP
HSPAIIFEGQKLSYEELAKKVYSLTNWLTAEGVTLGDRIAVCVPRSEELIVVQQAILAAG
AVYVPVDPDYPEGRIHYMLESSAPKFVFSTSALQDKLPHGVEVKLVDDDTLPTIYKRVEP
LPPQVKPEPHSPAYMIYTSGSTGKPKGVVVTHDAIVNRLLWMHDQYPITAKDRVLQKTPA
GFDVSVWEFFWPMMVGSCLVIAKPDGHKDPIYLQDLIHREKITTLHFVPSMLQIFVQQAD
PDLCQSLRQVFCSGEALPIELVNHYYQAFNAPLHNLYGPTEAAVDVTYWPSEANTEGTSI
PIGRPVWNTQIYILDDALNPVPPGVVGHLYIAGRQLAQGYHGQPELTAERFIENPFGPQG
SRMYLSGDLARWREDGAIEYCGRSDFQVKIRGFRIELEEIENALANHPSVAQVAVLAQEY
NDGDKRLVAYVTAENTEQGIDSNALQTYLAEPLPEYMVPSYFVELEAFPLTPNGKLDRSA
LPKPDLSGQVGTKGPSNLVEERLCKLFCQLLDLPAVGVDDNFFELGGHSLLAAQLIAHVK
EIMGIELSLAAVFESPTVSGIAAKLNGSESDDALSILLPLRQREGKAAIFCVHPAGGLSW
CYAALTPIIPSNVPLYGVQARNLGDPSAPLPKSMKEMAEDYVAAIREEQPFGPYHLLGWS
IGGMIVHLMAGILQEQGQEVGLVTLLDSYPTEQWQTIHPPGEEQALGALIRMAGVEFDEA
AHSSITKPEVIDILQDAGSSMAHLSTETITAMIEVVINNNQRVRDAVDYHYQGDVLFFNA
EKPPEESFLDRNGWFKYMEGDLKVVDVACLHRDMMRPEMLRLIGTHMVKELRERFDV
NT seq 3954 nt   +upstreamnt  +downstreamnt
atgaacatgtacgatttaccttatacagcggagcaactgttgccgctgacggatgcccaa
gccgggatttggtttgcccagttgcgcgatccagaaaatccaatttacaagacaggtgaa
tacctagtgattgatggcaaggtggatgagccttgttttgttgaagcggttaaaacggcg
attgatgaggtagattccttacacgctaagtttgtcaccaccaccgaaggcccgcgcatg
gtgattgaccgccaaaactggcaggtagagcgaatcgatttctcacaacaagatgcaccg
ctggatgcagccgttgattggatgaagtcagagctgaaacaacctgtcgatttagagcaa
ggcccattattcgttatggcattgctcaagctttcagaagaccagttcgtgtggttccta
tcgctgcatcacatcgcgattgatggctacagcatgtccttggtggcgggacgcgtggca
catatttatggccaacttgctcaggggaaaccattcgacaagatcgagtttgtcgaccag
caagccttgctaaaagaagacgacgactacaaagcgtcggagaaataccaaaaagatcgc
gctttctatcttcaacgttacgcagaccattcagataccgtcaaccttgcaggcaaaccg
accgttacatcagaccgctttttacgtttaaaaggcgcgatggaggtcgacgatttccaa
cgtatggaatcactggcgaaacagtgtcgcacccactggtacagcgtgctcattgcatct
attgccgcttatgtgcaccgtatgacgcgttctaatgaagttgttcttggtgtgcctttg
atggggcgtttaggttctgttgcgattcaaacaccagcgatgcgcgtgaacattttgccc
gtgcgcgtcagctttgaacaaggcttggatattaagatgctggtcaaacaggtcaaccaa
gagttttcctcggttcgtcgtcaccaaagctaccgttatgaagagcttcaccgtgagctt
aacttggtaaaagacaaccgtaacctatttggccccttggttaatatcatgccgtttgaa
tacgagcataaatttggcgagcttaattccaaagcgcataacttgtccgctggtccagtg
gatgatatctcgttttattgttacgagcttgatggtcagcttcatatcgatatggatgcc
aatcctgagttgtattccgagaaagatattcacgagcatcaacagcgtttgttccacttt
atgagcgacttttttgcaatcgcgcaagctcaagatccagctctttgccaagtcagcgat
atcaatattcttcttgctggtgagcgagagaaagtcatcgaaacttggaacgacactgac
cacgaggtacccgagacgacgttagccgctctgttggcaaggcagcgtattcttaccccc
cattcaccagcaataatctttgaaggccaaaagctcagctacgaagagttagcgaaaaaa
gtctactcgttgaccaactggctgacggcagaaggcgttactctgggtgatcgcatcgcg
gtatgtgtgccaagaagtgaagagttgatcgttgtacagcaggcgattctggccgcaggt
gcggtttatgtaccggtggacccagattatccagagggccgtattcactacatgctagag
tcctctgcgcctaagtttgtgttctctacgtcggcactgcaagacaagttgccgcacggt
gtggaagtgaaactggtcgatgatgacaccttgccaaccatttacaaaagagtcgagcca
ctgcctccgcaagtgaagccagagccgcactctccggcctacatgatttacacctctggt
tcgacgggcaaaccaaaaggtgtggtggtcacccatgatgcgatcgttaaccgattgcta
tggatgcatgaccaatatccgattactgcgaaagatcgcgtgttgcaaaaaacgcctgcg
ggctttgatgtgtcggtgtgggagttcttttggccaatgatggttggctcatgtttagtg
atcgcgaaaccggacggacacaaagatccgatttatctgcaagatcttattcatcgcgag
aagatcaccacgctgcactttgtgccatctatgctgcaaatctttgttcagcaggcggac
cccgatttatgtcaaagcttacgccaagtgttctgtagcggtgaagcgttgcctatcgag
ttagttaatcactattaccaagcattcaacgcgcctctgcataacctttatggcccaaca
gaagcggctgtggatgtgacttattggccaagtgaagccaataccgaaggcacgtcgatt
ccaatcgggcgtccagtgtggaacacgcaaatctacattcttgatgatgcattaaatcca
gtaccgccgggtgtggtagggcacttgtacattgctgggcgacaattggcacaaggctac
catggtcagccagaactgacggcagaacgctttatcgaaaatccatttggtccacaaggt
agccgaatgtatctatcgggcgatttggctcgttggcgtgaagatggtgcgattgagtac
tgtggccgtagtgactttcaggtcaagatccgcggtttccgtattgagctggaagaaatt
gagaatgccttggccaaccatccaagtgttgctcaagtggcagtgttggctcaggaatac
aatgacggcgacaaacgcttggttgcttacgtcactgcagagaatactgagcagggtatc
gatagcaatgcattgcaaacgtacctcgcggaaccactgccagagtatatggtgccgagc
tactttgttgagcttgaagcctttccattaacgcctaacggcaaattggaccgcagcgca
ctaccgaagccggatctgtctggtcaagtcggtaccaaggggccaagtaacttagttgaa
gagcgtttgtgtaagttgttctgtcagttattggatctgcctgcggtcggtgtggatgac
aacttcttcgagcttggcgggcactccctattggctgcgcagttgattgcccacgtgaaa
gaaatcatggggattgagttgtcattggcggcggtatttgaatcgccaacggtttccggt
atcgcggccaagctcaacggcagcgaaagtgatgatgcactgagcattttgttaccgctg
cgtcagcgtgaaggcaaagcggctatcttctgtgtacaccccgctggtggtctgagttgg
tgttacgcggcactgacgccaatcattccgtctaatgttccgctttatggtgtccaagct
cgtaaccttggtgacccttctgcaccattaccaaagagcatgaaggagatggcagaagac
tacgtggctgcgattcgtgaagagcaaccctttggaccttaccatcttctgggttggtcg
attggcggcatgattgttcacctaatggcgggcatcttacaagagcaaggccaagaggtg
ggcttagtcacgttgctggattcttatcctacagagcagtggcaaaccattcatccaccg
ggagaagagcaagcgcttggtgcactgatccgtatggcgggggttgagtttgatgaagcc
gctcattccagcatcactaagccagaggtgatcgacatcctgcaagatgcaggttcttcc
atggcgcacctgagcaccgagaccatcacagccatgattgaggtggtgatcaacaacaac
cagcgtgtacgtgatgcggtggattaccactaccaaggtgatgtgttgttcttcaacgct
gagaagccaccagaagagtcgttcctcgatcgtaatggctggttcaagtacatggagggc
gacctcaaagtggttgatgtggcctgtttgcaccgtgacatgatgcgtccagagatgctg
cgtttgattggtacccacatggtgaaagagctaagagagaggttcgatgtttga

KEGG   Vibrio campbellii: VIBHAR_01403
Entry
VIBHAR_01403      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K02362  enterobactin synthetase component D [EC:6.3.2.14 2.7.8.-]
Organism
vha  Vibrio campbellii
Pathway
vha01053  Biosynthesis of siderophore group nonribosomal peptides
vha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    VIBHAR_01403
Enzymes [BR:vha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     VIBHAR_01403
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     VIBHAR_01403
SSDB
Motif
Pfam: 4PPT_N ACPS APC_r
Other DBs
NCBI-ProteinID: ABU70379
UniProt: A7MZS3
Position
I:complement(1420075..1420815)
AA seq 246 aa
MNGNLLKVTQLKNEAPDSPLAPFHLYLKGASPKVYIVQATPEMYSQVGLPEEEKHIQKAV
EKRQREFRAGRHAARSAMQNLDLSKPSMTEMPILTGHFREPLFPSDISGSISHTDGICLA
ACAQKNEVASLGIDIESNTALAEHLFSSIYTRDEQALLNRTHDLPDTLIFSIKESIFKCC
FPFVQVYFDFLDAQITLEPKNKHSGQFSFALIGRNQDALKAKLPNLSFHGHYCFDQQYVL
SLCYFS
NT seq 741 nt   +upstreamnt  +downstreamnt
ttgaacggcaacttattgaaagtgacacaattgaaaaacgaagcgccagacagtcccctc
gccccttttcatctttacctaaaaggtgccagtccaaaggtttatatcgtgcaagccaca
ccggagatgtactctcaagtgggccttcccgaagaagaaaaacacattcaaaaggcagta
gagaagcgccaacgcgagttcagagcagggcgccacgcggcgcggtctgccatgcaaaat
ttggatttatccaaaccgagtatgacggagatgccgatcctgacaggtcactttagagag
cccctttttccaagtgatatcagtggtagcatcagccatactgatggcatttgccttgcc
gcgtgtgcccaaaaaaacgaagtcgccagcctaggaatcgatattgaaagcaataccgcg
cttgccgagcaccttttctcttccatctacactcgcgatgaacaagcactactcaaccgt
actcacgatcttcctgatacgctgatattcagtatcaaggaaagcatttttaagtgctgc
tttccctttgttcaggtgtactttgattttctcgatgcacagattacgttagagcccaaa
aacaaacattcagggcaatttagctttgcgttgattggccgcaaccaagacgcattgaaa
gcaaaattgccaaatctctcatttcatggacactactgttttgaccagcaatacgtgctc
tcgctgtgctacttttcctaa

KEGG   Vibrio campbellii: VIBHAR_02097
Entry
VIBHAR_02097      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01252  bifunctional isochorismate lyase / aryl carrier protein [EC:3.3.2.1 6.3.2.14]
Organism
vha  Vibrio campbellii
Pathway
vha01053  Biosynthesis of siderophore group nonribosomal peptides
vha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    VIBHAR_02097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:vha01008]
    VIBHAR_02097
Enzymes [BR:vha01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.1  isochorismatase
     VIBHAR_02097
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     VIBHAR_02097
Polyketide biosynthesis proteins [BR:vha01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    VIBHAR_02097
   Bacillibactin synthetase
    VIBHAR_02097
  Nonlinear NRPS
   Vibriobactin synthetase
    VIBHAR_02097
   Myxochelin synthetase
    VIBHAR_02097
SSDB
Motif
Pfam: Isochorismatase PP-binding
Other DBs
NCBI-ProteinID: ABU71062
UniProt: A7MVI7
Position
I:2093826..2094620
AA seq 264 aa
MRVLWSAYVLVHDLQTYFLNFFDKTKSPVPELLENVSKVLDNARSANIPVIYTAQPANQE
PNERALLTDFWGGGLTQDTDIAPEVSPQAGDIQYTKWRYSAFKKTPLHHWMQEEQRDQLI
IVGVYGHIGILSTALDAFMLDIKPFVIGDAIADFSEEDHLHTLKYVAGRSGCVKSVNEFI
KTMKPSDSSSAFSLESMRKDVADILDVDLDEVDVDENLIFLGLDSIRVMTLHSRWKALGF
NVELAEMVALHTIKDWWEATQVTV
NT seq 795 nt   +upstreamnt  +downstreamnt
atgcgggttttatggagcgcttacgttttagttcatgatttgcagacttatttcctcaac
ttctttgataaaacgaagtcaccagtaccagagcttttggagaatgttagcaaggttcta
gacaatgccagatcggcaaatatcccagttatctacactgctcagcctgcaaatcaagaa
ccgaatgagagggcacttctgaccgacttctgggggggaggtctaactcaagatactgat
attgctccagaagtatcacctcaagctggtgatattcaatataccaagtggcgttatagt
gcatttaagaaaacgccattacatcactggatgcaagaagagcaaagagatcagctcatc
attgttggtgtgtacggccatattggcattttatcgacagcgttggatgcgtttatgcta
gacatcaaacctttcgttattggtgatgcgatcgcggatttctccgaagaagatcatctt
catactctcaaatatgtcgctggaagaagcgggtgtgtgaaatccgttaatgaatttatc
aaaacgatgaagccatcagattcatcaagcgctttcagcttagagtctatgaggaaggat
gtcgcggatatacttgacgttgatttggatgaggtggacgttgatgaaaatcttatcttc
cttggtttggattcaattcgagtaatgacactgcacagccgctggaaggcactaggtttt
aatgtcgaactggcagaaatggtggctctacataccatcaaagactggtgggaggcgacg
caagttaccgtttaa

DBGET integrated database retrieval system