KEGG   Vibrio campbellii: VIBHAR_02420
Entry
VIBHAR_02420      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
vha  Vibrio campbellii
Pathway
vha00010  Glycolysis / Gluconeogenesis
vha00620  Pyruvate metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VIBHAR_02420
   00620 Pyruvate metabolism
    VIBHAR_02420
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     VIBHAR_02420
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ABU71382
UniProt: A7MZM0
Position
I:complement(2431616..2433136)
AA seq 506 aa
MIYAQPGSENAIVNFKSHYDNYIGGEWVKPTGGEYFDNTSPINGQAYCKVARSGEADINL
ALDAAHGVRAQWAKTSVTERSNILLKIADRIEQHLEELAVAETWENGKPVRETLAADLPL
VVDHFRYFAGCIRAQEGSAAELDEHTASYHFPEPIGVVGQIIPWNFPMLMAAWKLAPALA
AGCCVVLKPAEQTPTSILVLMETIGDLLPAGVVNVVNGFGSEAGQALATSNRIAKLAFTG
STEVGNHILKCAAENLIPSTVELGGKSPNIYFPDVFDHEDEYLDKCIEGTLLAFFNQGEV
CTCPSRVLVHESVYDKFIAKVAERAQTIKQGNPLDTDTQVGAQASQEQFDKILSYLEIGR
QEGAKVVFGGDVAKQENDLEQGYYIQPTLLQGHNKMRVFQEEIFGPVIAVTTFKDEAEAL
AIANDTEYGLGAGVWTRDQNLAYRMGRNIEAGRIWINCYHAYPAHAAFGGYKKSGIGRET
HKMMLDHYQNTKNLLISYDVNPLGFF
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgatttatgcacagccaggtagtgaaaatgccatcgttaattttaaatcgcattacgac
aactacatcggtggcgaatgggtaaaaccaacgggtggtgaatactttgacaatacatcg
ccaatcaatggccaagcgtattgtaaggtggctcgttctggagaagcagacatcaatctt
gcactggatgctgcacatggcgtaagagcgcaatgggcgaaaaccagtgtgactgaacgc
tcgaacattctactgaagattgccgatcgcattgaacaacatcttgaagagctggctgtg
gcagaaacatgggaaaacggcaaacccgttcgtgaaacgttagccgcagacttgcctttg
gtcgtcgaccattttcgttacttcgcaggttgtatccgtgctcaagaaggcagtgcggcc
gagttagatgagcacaccgcaagttatcacttccctgagccgattggggttgttgggcag
atcatcccttggaacttccctatgttgatggcggcttggaaacttgctcctgcattggct
gcgggctgttgtgttgtgctaaaacctgccgaacaaacgccaacttcgattctcgttctg
atggaaacaattggtgaccttctgcctgctggcgtggtgaatgtagtcaatggctttggc
tcagaagcagggcaagcactggcgacgagtaaccgaatcgctaagttggcatttacgggt
tcaacagaagtcggtaaccatattttgaaatgcgccgcagagaaccttattccatcaacg
gttgagcttggtggtaaatctccaaatatctacttcccagatgtgtttgaccacgaagac
gaatacctagataagtgcattgaaggcactttacttgcgttcttcaaccaaggggaagtg
tgtacctgtccatcacgtgtgttagtgcatgagtctgtgtacgacaagtttattgctaaa
gtcgcagagcgcgcgcagacaatcaagcagggtaatccactcgatacagatactcaggtt
ggcgctcaagcctcgcaagagcagttcgataagatcctgagctacctagaaatcggtcgt
caagaaggcgcgaaagtcgtgtttggtggcgatgtagcgaaacaagaaaacgacttggag
caaggctactatatccaaccgactttgttacaaggtcacaacaagatgcgcgtattccaa
gaagagatctttggcccagtcatcgcagtgaccaccttcaaagatgaagcggaagcacta
gcgattgccaatgacacggaatatggcttgggtgcaggtgtgtggacgcgagaccaaaac
cttgcttatcgcatggggcgcaacattgaagcagggcgcatttggattaactgctatcac
gcttacccagcacacgctgcgtttggtggctacaagaaatcaggtatcggccgtgagacg
cataagatgatgcttgatcactaccaaaacacgaaaaacctactcattagctacgacgtc
aatccgttaggcttcttctaa

DBGET integrated database retrieval system