Vibrio navarrensis: IF132_10720 Help Entry IF132_10720       CDS       T07785                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism vnv  Vibrio navarrensis Brite KEGG Orthology (KO) [BR:vnv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vnv03032]     IF132_10720    03036 Chromosome and associated proteins [BR:vnv03036]     IF132_10720    03400 DNA repair and recombination proteins [BR:vnv03400]     IF132_10720 DNA replication proteins [BR:vnv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IF132_10720 Chromosome and associated proteins [BR:vnv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IF132_10720 DNA repair and recombination proteins [BR:vnv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IF132_10720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Arteri_nsp7a Motif Other DBs NCBI-ProteinID:  QOD69287 Position 1:complement(882566..882838) Genome browser AA seq 90 aa AA seqDB search MNKTQLVESIAANADISKASAGRALDAFIEAVSTTLESGEQVALVGFGTFSVRTRAARTG RNPKTGEEIQIAEAKVPAFKAGKALKDACN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaaactcaactagtagaatccatcgctgcaaatgcagatatctctaaagcgtca gcaggtcgtgccctggatgcattcattgaagccgtaagcaccacccttgagtctggcgag caggtcgctctagttggcttcggtacgtttagcgtacgtactcgtgcagcacgcactggt cgtaacccaaaaacgggtgaagaaatccaaatcgcagaagcaaaagtacctgcattcaaa gcgggtaaagcgctgaaagatgcttgtaactga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (6) Pfam (6) All databases (7) Download RDF

DBGET integrated database retrieval system