KEGG   Vpept: 1461111-3
Entry
1461111-3         CDS       T49000                                 
Symbol
2C
Name
(KEGG) Enterovirus A protein 2C
  KO
K01516  Enterovirus protein 2C [EC:3.6.1.15]
Taxonomy
TAX:138948 [GN:T40103]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Picornavirales; Picornaviridae; Enterovirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: RNA_helicase Helicase_RecD AAA_16 DUF2075 GldM_N Zeta_toxin
Other DBs
NCBI-ProteinID: NP_740532 NP_042242
GB: NC_001612
AA seq 329 aa
SASWLKKFNDMANAAKGLEWISNKISKFIDWLKEKIIPAAKEKVEFLNNLKQLPLLENQI
SNLEQSAASQEDLEAMFGNVSYLAHFCRKFQPLYATEAKRVYALEKRMNNYMQFKSKHRI
EPVCLIIRGSPGTGKSLATGIIARAIADKYHSSVYSLPPDPDHFDGYKQQVVTVMDDLCQ
NPDGKDMSLFCQMVSTVDFIPPMASLEEKGVSFTSKFVIASTNASNIIVPTVSDSDAIRR
RFYMDCDIEVTDSYKTDLGRLDAGRAARLCSENNTANFKRCSPLVCGKAIQLRDRKSKVR
YSVDTVVSELIREYNNRYAIGNTIEALFQ
Comment
vg:1461111 1112..1440

DBGET integrated database retrieval system