KEGG   Vpept: 1461114-3
Entry
1461114-3         CDS       T49000                                 
Symbol
2C
Name
(KEGG) Enterovirus B protein 2C
  KO
K01516  Enterovirus protein 2C [EC:3.6.1.15]
Taxonomy
TAX:138949 [GN:T40104]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Picornavirales; Picornaviridae; Enterovirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: RNA_helicase AAA_16 Zeta_toxin AAA_22
Other DBs
NCBI-ProteinID: NP_740543 NP_040958
GB: NC_001472
AA seq 329 aa
NSGWLKKFTEMTNACKGMEWIAIKIQKFIEWLKVKILPEVKEKHEFLNRLKQLPLLESQI
ATIEQSAPSQSDQEQLFSNVQYFAHYCRKYAPLYAAEAKRVFSLEKKMSNYIQFKSKCRI
EPVCLLLHGSPGAGKSVATNLIGRSLAEKLNSSVYSLPPDPDHFDGYKQQAVVIMDDLCQ
NPDGKDVSLFCQMVSSVDFVPPMAALEEKGILFTSPFVLASTNAGSINAPTVSDSRALAR
RFHFDMNIEVISMYSQNGKINMPMSVKTCDEECCPVNFKKCCPLVCGKAIQFIDRRTQVR
YSLDMLVTEMFREYNHRHSVGATLEALFQ
Comment
vg:1461114 1098..1426

DBGET integrated database retrieval system