KEGG   Vpept: 1461118-3
Entry
1461118-3         CDS       T49000                                 
Symbol
2C
Name
(KEGG) Enterovirus D protein 2C
  KO
K01516  Enterovirus protein 2C [EC:3.6.1.15]
Taxonomy
TAX:138951 [GN:T40106]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Picornavirales; Picornaviridae; Enterovirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: RNA_helicase AAA_16 Torsin Zeta_toxin DUF2075 AAA_22 AAA_30 AAA
Other DBs
NCBI-ProteinID: NP_740744 NP_040760
GB: NC_001430
AA seq 330 aa
SDSWLKKFTEACNALRGLDWLAQKIDKFINWLKTKILPEAREKHEFVQKLKQLPVIESQI
NTIEHSCPNSEXQQALFNNVQYYSHYCKKYAPLYALEAKRVSALERKINNYIQFKSKSRI
EPVCLIIHGSPGTGKSVASNLIARAITEKLGGDSYSLPPDPKYFDGYKQQTVVLMDDLMQ
NPDGNDIAMFCQMVSTVDFIPPMASLEEKGTLYTSPFLIATTNAGSIHAPTVSDSKALAR
RFKFDMEIESMESYKDGVRLDMFKAVELCNPEKCRPTNYKKCCPLICGKAIQFRDKRTNV
RYSVDMLVTEMIKEYRIRNSTQDKLEALFQ
Comment
vg:1461118 1114..1443

DBGET integrated database retrieval system