KEGG   Vpept: 1489680-1
Entry
1489680-1         CDS       T49000                                 

Symbol
nsp1
Name
(KEGG) SARS-CoV host translation inhibitor nsp1
  KO
K25011  SARS coronavirus host translation inhibitor nsp1
Taxonomy
TAX:227984 [GN:T40069]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus; Severe acute respiratory syndrome coronavirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: bCoV_NSP1
Other DBs
NCBI-ProteinID: NP_828860 NP_828849
GB: NC_004718
AA seq 180 aa
MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGV
LPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRN
VLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG
Comment
vg:1489680 1..180

DBGET integrated database retrieval system