KEGG   Vpept: 1491970-5
Entry
1491970-5         CDS       T49000                                 
Symbol
NS6
Name
(KEGG) Norovirus GI 3C-like protease
  KO
K25325  Norovirus 3C-like protease [EC:3.4.22.66]
Virus
122928  Norovirus GI
SSDB
Motif
Pfam: Peptidase_C37 Peptidase_C24
Other DBs
NCBI-ProteinID: NP_786949 NP_056820
GB: NC_001959
AA seq 181 aa
APPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRF
SKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGM
LLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETAL
E
Comment
vg:1491970 1101..1281

DBGET integrated database retrieval system