KEGG   Vpept: 41871946-5
Entry
41871946-5        CDS       T49000                                 
Symbol
NS6
Name
(KEGG) Norovirus GII 3C-like protease
  KO
K25325  Norovirus 3C-like protease [EC:3.4.22.66]
Virus
122929  Norovirus GII
SSDB
Motif
Pfam: Peptidase_C37 Peptidase_C24
Other DBs
NCBI-ProteinID: YP_009701452 YP_009701445
GB: NC_044932
AA seq 181 aa
APPSLWSRIVNFGSGWGFWVSSNLFITSTHVVPPGMTEAFGVPTSQIQIHRSGEFCKMRF
PKAIRPDVSGMILEEGAPEGTVVTILIKRTTGELMPLAARMGTHATMKIQGRMIGGQMGM
LLTGSNAKNMDLGTVPGDCGCPYVYKRGNDWVVIGVHTAAARGGNTVICATQGPDGEATL
E
Comment
vg:41871946 1006..1186

DBGET integrated database retrieval system