KEGG   Vpept: 43740578-1
Entry
43740578-1        CDS       T49000                                 

Symbol
nsp1
Name
(KEGG) SARS-CoV-2 host translation inhibitor nsp1
  KO
K25011  SARS coronavirus host translation inhibitor nsp1
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: bCoV_NSP1
Other DBs
NCBI-ProteinID: YP_009724389
GB: NC_045512
AA seq 180 aa
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV
LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK
VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG
Comment
vg:43740578 1..180

DBGET integrated database retrieval system