KEGG   Vpept: 919920-8
Entry
919920-8          CDS       T49000                                 
Symbol
2C
Name
(KEGG) Enterovirus C protein 2C
  KO
K01516  Enterovirus protein 2C [EC:3.6.1.15]
Taxonomy
TAX:138950 [GN:T40105]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Picornavirales; Picornaviridae; Enterovirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: RNA_helicase AAA_16 DUF2075 Torsin Zeta_toxin AAA_22 Rad17 PcF DrrA_P4M AAA AAA_19 DUF3987 DUF5906 AAA_5 AAA_30
Other DBs
NCBI-ProteinID: NP_740473 NP_041277
GB: NC_002058
AA seq 329 aa
GDSWLKKFTEACNAAKGLEWVSNKISKFIDWLKEKIIPQARDKLEFVTKLRQLEMLENQI
STIHQSCPSQEHQEILFNNVRWLSIQSKRFAPLYAVEAKRIQKLEHTINNYIQFKSKHRI
EPVCLLVHGSPGTGKSVATNLIARAIAERENTSTYSLPPDPSHFDGYKQQGVVIMDDLNQ
NPDGADMKLFCQMVSTVEFIPPMASLEEKGILFTSNYVLASTNSSRISPPTVAHSDALAR
RFAFDMDIQVMNEYSRDGKLNMAMATEMCKNCHQPANFKRCCPLVCGKAIQLMDKSSRVR
YSIDQITTMIINERNRRSNIGNCMEALFQ
Comment
vg:919920 1128..1456

DBGET integrated database retrieval system