KEGG   Vanderwaltozyma polyspora: Kpol_1016p5
Entry
Kpol_1016p5       CDS       T01049                                 

Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo03440  Homologous recombination
vpo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Kpol_1016p5
   03450 Non-homologous end-joining
    Kpol_1016p5
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vpo03400]
    Kpol_1016p5
DNA repair and recombination proteins [BR:vpo03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     Kpol_1016p5
   NHEJ (non-homologous end-joining)
    MRX complex
     Kpol_1016p5
SSDB
Motif
Pfam: FHA FHA_2
Other DBs
NCBI-GeneID: 5544210
NCBI-ProteinID: XP_001643924
UniProt: A7TNS3
AA seq 812 aa
MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD
CIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNLSWEVKRCNYMKTDM
DMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILINSKTLRDILT
NNIIMTKKFDSYWVKLNSHESNIQNHTINVTKLAKSLKGMHMFLLDPESYNCEYFEKFLE
EIGCIPRKFLNINDLETYLETQFKGGEFLLLSSAKLENQSRLERFISIPLESFLDKLLFL
DLDFGQSINRSKEESKNVIEPVLKEVGVEQTTEAVPISKNVEIYEPQPKKRRLNRSRVKP
LDSLNFFAGGVTSIGASQLPLPVEEANNITRKKDKEVIKSQGKGEINIETEMDESGNGEL
LSTASEFKKPKSDVQHKLEKRMQVAIDRSPEKIKKPKLEENISIQQLLSNKVKSTSDTSS
VLIETQIAKESNTKAIEYGKVRQKTLTDYKHTSDERIERPSVDLVHAIQDIKERETLRVK
TSIVEIKENELTEEAINKFSDLTVVDINTRLFKDKSLDINKPANSNQNNMDWSGKKNFKK
FVKMVPKYKRSQGNGQHADSCSTFIRNSAMLITRNFVPMKQYSKLDNNSNSNEMTDFSNI
EVNKKPVEKNREAYSSDDSVDEPSFTFTRNSSSKQLFVMDESINEDSLNMINDKGLQEMS
QNSIANSNFEVPNYKDRGNKSSDSSSGKEYMTKSSYTSFNYNRENSNGQVEKNSSGVHKI
GIDQNSEVINNNDDDDDDDDEDMPKFRFRKNR
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgtgggttcttaggtatcagtatagtttagatgatggttcagtggaaaaaatatcctgc
tgcatacggaatgaagaaacatattatttggggagatcgagcaagaatcaattgtcagtc
agaaatgataaaagcatatcaagacaacagatatcaatacaatgggatagggataaggat
tgtattatggtgaaaaatcttggaaaagttactatggtagaagaaagatatttatcagat
ggtgaaactctaagttttcagtcaaagaatgatttagttacaatgaagattggtactaca
ccaatagtggtaaatctaagctgggaggttaaaagatgcaattatatgaagactgatatg
gatatggtacacttgttgcaatcttatggtttccaaccgactacaattgaaaattcacat
tctttggatatgataattcagaatgacgttaccactattagtgataaatacttgaagtgt
tattcgatgattcatgatactattttgatcaattcgaaaactctaagagatatcctaaca
aataatataataatgacgaaaaaatttgacagctattgggtcaagcttaatagccatgaa
tcaaatattcaaaaccatacaattaatgttacgaaactagcgaaatctttaaagggtatg
catatgtttttacttgatccagagtcttacaactgtgaatattttgaaaagtttttggag
gagattggttgtattccaaggaaatttttaaatatcaatgatttggagacctatctcgaa
actcaattcaaaggtggcgagttcctcttgttatcttctgctaaattagaaaatcagtct
aggttggaacgatttatttcaattcctttagaatcatttttagataagttattattttta
gatcttgattttggtcaatcaatcaatagatccaaagaagaatctaaaaatgtaatagaa
cctgtcttaaaagaagttggagtggaacagacaactgaggcggtacctataagtaaaaat
gttgaaatttatgaacctcaacctaaaaaacgtcgtttaaatcgttcaagagtcaagcct
ctagatagtttgaatttttttgcaggaggtgtcacttcaataggagcgtctcaacttcct
ttgccagttgaagaggctaacaacataactagaaaaaaagataaagaagttattaaaagt
cagggaaaaggggaaataaatatagaaactgaaatggatgagtcaggaaacggtgaatta
ctatctactgcatcagaattcaagaaaccaaagagcgatgtacaacacaaactggaaaaa
agaatgcaggttgcaattgacagatcaccagaaaagattaaaaaacctaaacttgaagaa
aatatttctattcaacaactgctttctaacaaagtaaagtcaacttcagacacaagtagt
gtattaattgaaactcaaattgcaaaggaaagtaatactaaggcaattgaatatgggaag
gttcgccagaaaacattgactgattataaacatacctctgatgaacggatagaaagacca
tcagttgacctagtacatgccattcaagacataaaagagagagaaaccctgagggtaaaa
acatctatagtggaaataaaggaaaacgagttaacagaggaagcaattaacaagttcagc
gatttaactgttgtggatatcaatacaagattattcaaggataagagtctagatataaat
aaaccagcaaattccaatcagaataatatggattggtctggcaagaaaaactttaaaaaa
tttgtaaaaatggtcccaaaatataagagatctcaaggaaatgggcaacatgcagattcc
tgttctacatttataagaaattcagccatgctaattacaagaaattttgtaccaatgaaa
cagtattcgaaattagataataattcaaactcaaatgagatgacagatttctctaatata
gaggtaaataaaaaaccagttgagaaaaatagagaagcttactctagtgacgatagcgta
gatgaaccatcttttacgttcactagaaattcatcatcaaaacaactatttgtaatggat
gagagtataaacgaagactcattaaatatgatcaatgacaaaggtttgcaagaaatgtcc
cagaattccattgccaatagtaacttcgaagttcctaattataaggacagaggtaataaa
tcatcagattcatcttctggtaaagaatacatgaccaagtcatcttacacatcctttaac
tacaatagggaaaattcaaacggtcaagttgaaaaaaatagtagcggcgttcataaaatt
ggtattgatcaaaacagtgaagttattaataataatgatgacgatgatgacgatgacgat
gaagatatgccaaaattcagatttaggaagaacagatag

DBGET integrated database retrieval system