KEGG   Vigna radiata (mung bean): 106763357
Entry
106763357         CDS       T04126                                 

Name
(RefSeq) UDP-glycosyltransferase 2
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00943  Isoflavonoid biosynthesis
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    106763357
Enzymes [BR:vra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     106763357
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 106763357
NCBI-ProteinID: XP_014503043
UniProt: A0A1S3UAI7
Position
1
AA seq 467 aa
MKDTIVLYPNIGRGHLVPMVELGKLILSHHPSLSITILILTPSPNATFTLACNSNAQYIA
AVSATIPAITFHSVPMAQLPLNSPSLPPHLISLELSRHSTQNVSLALQSLVKASNIKALV
MDFLNFSNPKTLTENLTTDIPTFFYYTSAASSLIVLFHFYATLPKQIKDQQFLLHCPGLP
AISMDDFPIESLDPLNYTNQIFSQIAEAMKGSSGIIINTCEAIEEKAIAVLNDDGTVPPL
FCVGPVISASYGEEDKGCLSWLESQPSQSVVLLCFGSMGWFSREQLKEMAIGLEKSQQRF
LWVVRTELECGDSVEEKPSLDELLPEGFLDRTKEKGLVVRDWVPQREILSHDSVGGFVTH
CGWNSVLEAVCEGVPMVAWPLYAEQKLNRVFMVQEMKVALALKEEKDGSVSGSELGERVR
ELMESDTGKEIRQKVFKMKLSAAEALNEGGTSRVALDKLAMSWRSVI
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctgtaccccaacattggtaggggtcacctagtgccgatggtg
gagctaggaaagctcattctatcccaccacccttctctttccatcaccatcctcatcctc
accccatcccccaacgccactttcaccctagcctgcaactccaacgcccaatacatcgcc
gccgtctccgccaccatccccgccatcacctttcacagcgttccaatggcccaactcccc
ctcaacagcccttccctcccccctcacctcatctcccttgaactctcccgccacagcacc
caaaacgtttcccttgcactccaaagcctcgtcaaagcctccaacatcaaggccctagtc
atggacttcttaaactttagcaaccccaaaactctcactgaaaatctcaccacagacatc
cccactttcttctactatacatccgcagcctccagcctcattgtgctttttcatttctac
gccactctcccaaaacaaatcaaagatcaacagtttctacttcactgcccagggttgcct
gctatctccatggatgactttccaatcgaatccctcgaccctttgaactacactaaccag
attttctctcagatagcggaagccatgaagggtagttctgggattataataaacacttgt
gaagcgattgaagagaaagccattgcagtgttgaacgacgatgggaccgtgcctccgttg
ttttgtgtgggccccgtgatttctgcatcatatggggaagaagacaaaggatgtctgagt
tggctcgagtcccaaccgagtcagagcgtggtgttgttgtgtttcggaagcatggggtgg
ttctcgagggagcagttgaaggagatggctattgggttagagaagagccagcaaaggttc
ttgtgggtggtgaggactgagttggaatgtggtgactcggtggaggagaaaccgagtctg
gacgagttgttgccagaaggatttttggataggacgaaggagaaggggttggtggtgcgg
gactgggtcccacagagggagattctgagtcatgactcagtgggggggtttgtgactcac
tgcgggtggaactcggtgctggaagccgtgtgcgaaggggtgccaatggtggcgtggcca
ttgtacgccgagcagaagctgaatagggtgtttatggttcaggaaatgaaggttgctttg
gcgctgaaggaggagaaagatgggtcagtgagtgggagtgagttgggggagcgagtgagg
gaactcatggaatctgacacggggaaagaaattcgtcagaaggttttcaagatgaaactc
agtgctgcagaagcattgaatgaaggtggaacttcacgtgttgcgttggataagttggcc
atgtcatggagaagtgtaatatag

DBGET integrated database retrieval system