KEGG   Vigna radiata (mung bean): 106774972
Entry
106774972         CDS       T04126                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1-like
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
vra  Vigna radiata (mung bean)
Brite
KEGG Orthology (KO) [BR:vra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106774972
Enzymes [BR:vra01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     106774972
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 106774972
NCBI-ProteinID: XP_022642745
UniProt: A0A3Q0FFA5
Position
10
AA seq 503 aa
MVLRLFILSKMQGPACSNATSPICSETSFFTILQRTQNTHFFKIHRSHPFLKPCPKAKSV
SLKAYSSMDFIHVKQASILKEAKHACKKLIRENPVESLHMVDIIQRLGIEHHFEEEIKAV
LQKQQLILSNHPCDFFNSHDQLHEVALAFRLLRQGGHYVKPDLFDILKSEKIKFKETYGE
DVKGLTALYEASQLGIEEDSLDEVGYLVFQHLHAWLTRHEKHSEAIYVTNTLRCPLHHGL
SRFRDRSIFPIQFNTDNEWITFLEELAEINSCLVMLMNQKEIIEVYKWWKTLEMAKEEKF
CSYQPLKWYLWPMACFTNPCLSEQRIELTKFISLIYIVDDIFDVYGTLDQLTLFTDAIIR
WELGGTEQLPDFMKMCLSVLFDMTNDVAEKVYKRHGLNPIDTLKRSWVRLLNAFMEEAHW
LRSGDLPRSEEYLKNGIVSTGLHVVLLRAFFLLDESINMETVAVMDKFPQIVHSVAKILR
LSDDLEGAKKKRKELMGHILIAT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggtgcttcgtctttttattttgtcaaagatgcaaggaccagcgtgctcaaacgccacg
tcccccatttgttcagaaacctcattctttacaattcttcaacgtacccaaaatactcat
ttcttcaaaatacatcggagccatccatttctaaagccttgccctaaagccaagtcagtt
tcactcaaagcatattccagcatggattttatccacgtcaagcaggcttcgatattgaag
gaagctaagcatgcatgcaagaaacttatcagagaaaatccagtggagagtttgcatatg
gttgacattatccaaaggcttggcattgagcaccactttgaagaggagattaaagcagtt
cttcaaaaacaacaattgatattaagcaaccatccctgtgattttttcaatagccatgat
caactccatgaagttgcacttgcatttcgcttgctgagacaaggaggtcattatgtcaaa
ccagatttatttgacattctgaagagcgagaaaataaaatttaaagagacatatggtgaa
gatgttaagggtctcactgccctgtatgaagcaagtcaactaggaattgaagaagatagc
cttgacgaggtagggtacctcgtctttcaacatcttcatgcatggcttacaagacatgaa
aaacattctgaagctatatatgttacaaacactcttcgctgtcctcttcatcatggatta
tcaagattcagggacagaagcatttttccaattcagttcaacaccgataatgaatggatc
accttcttagaggaacttgctgaaatcaattcctgcttggttatgttgatgaaccagaaa
gaaatcattgaagtatataaatggtggaaaacccttgaaatggcgaaggaggagaaattc
tgtagttaccaacctcttaaatggtacctgtggcccatggcgtgcttcacaaatccatgc
ctttcagaacaaaggattgagctcactaaatttatctctctaatctatattgttgacgac
attttcgatgtttatgggacattggaccaacttaccttatttacagatgctattattaga
tgggaattaggtggtacagagcagcttccagacttcatgaaaatgtgtctgagtgtcctt
ttcgacatgaccaatgatgtcgcagaaaaggtctacaaaagacatggattaaaccctata
gataccctaaaaagatcgtgggtgcgattgttgaatgctttcatggaagaggcacattgg
ttgaggagtggtgatttgccaaggtcagaggagtacttgaagaatggaatcgtgagcaca
ggactgcatgtggtgcttctccgtgcattcttcctcttggatgagtctataaatatggag
actgttgctgttatggataagtttcctcaaattgttcattcagtggcaaaaattcttcgt
ttatctgatgatttggaaggagccaagaagaagagaaaggagttgatgggtcatatcttg
attgctacatga

DBGET integrated database retrieval system