KEGG   Vigna unguiculata (cowpea): 114181375
Entry
114181375         CDS       T06017                                 

Name
(RefSeq) isoflavone 7-O-glucosyltransferase 1-like isoform X1
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00943  Isoflavonoid biosynthesis
vun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    114181375
Enzymes [BR:vun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     114181375
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 114181375
NCBI-ProteinID: XP_027923614
Position
4
AA seq 469 aa
MKDTIVLYPNIGRGHLVSMVELGKLILSHHPSFSITILILTPSSNATFTQACNSNARYIA
AVSATIPAITFHSVPMAQLPLDTPSLPPHLISLELSRHSTQNVALALQSLAKASNIKALV
MDFLNFSNPKTLTQNLTTNFPTFFYYTSAASSLIVLFYFSSVFPKQVQDQRFLLRFPGLP
AMSMDDFPNESSDPLSHTNQIFDQVGEAMKGSSGIIINTCEAIEEKAIAVLNEDATVPPL
FCVGPLISAPYGEEDKGCLSWLESQPSQSVVLLCFGSMGWFSRGQLKEIAIGLEKSEQRF
LWVVRTELEGGDSEEEKPSLDELLPEGFLDRTKEKGLVVRDWAPQREILSHDSVGGFVTH
CGWNSVLEAVCEGVPMVAWPLYAEQKLNRVFMVEEMKVALALKEEKDGLVSGSELGERVR
ELMESDTGKEIRQRIFKMKLSAAEALGEGGTSRVALDKLAMLCKSSFTI
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctgtatcctaacataggtaggggtcacctagtgtccatggtg
gagctaggcaagctcatcctatcccatcacccttcattttccatcaccatcctcatcctc
accccatcctccaacgccactttcacccaagcctgcaactccaacgctcgatacatcgcc
gccgtctccgccaccatccccgccatcaccttccacagcgtccccatggcccaactcccc
ctcgacaccccttccctcccccctcacctcatctccctcgaactctcccgacacagcacc
caaaacgttgcccttgcactccaaagcctcgccaaagcctcaaacatcaaagccctagtc
atggacttcttaaacttcagcaaccccaaaactctcactcaaaatctcaccacaaacttc
cccactttcttctactacacttccgcagcctccagcctcattgtgcttttttatttctcc
tccgttttcccaaaacaagtccaagatcaacggtttctacttcgcttcccagggttgcct
gcaatgtccatggatgactttccaaacgaatcctccgaccctttgagccacactaaccag
attttcgatcaggtaggggaagccatgaagggtagttctgggattataataaatacgtgt
gaagcgattgaagagaaagccattgcagtgttgaacgaggatgcgaccgtgccaccgttg
ttttgtgtgggccccttgatttctgcaccatacggggaagaagacaaaggatgtctgagt
tggctcgagtcccaaccgagtcagagcgtggtgttgttgtgtttcggaagcatggggtgg
ttctcgagggggcagttgaaggagattgctattgggttagagaagagcgagcaaaggttc
ttgtgggtggtgaggaccgagttggagggtggtgactcggaggaggagaaaccgagtctg
gacgagttgttgccggaagggtttttggataggacgaaggagaaggggttggtggtgcgg
gactgggcgccacagagggagattctgagtcatgactcagtgggggggtttgtgactcac
tgcgggtggaactcggtgctggaagccgtgtgcgaaggggtgccgatggtggcgtggcca
ttgtacgcggagcagaagctgaatagggtgtttatggttgaggaaatgaaggtggctttg
gcgttgaaggaggaaaaagatgggttggtgagtgggagtgagttgggggagcgagtgagg
gaactcatggaatcggacacggggaaagagattcgtcagaggattttcaagatgaaactc
agtgctgcagaagcattgggtgaaggtggaacttcacgtgttgcgttggataagttggcc
atgttatgtaaaagttctttcaccatttga

DBGET integrated database retrieval system