KEGG   Vigna unguiculata (cowpea): 114181452
Entry
114181452         CDS       T06017                                 

Name
(RefSeq) UDP-glycosyltransferase 2-like
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00943  Isoflavonoid biosynthesis
vun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    114181452
Enzymes [BR:vun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     114181452
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 114181452
NCBI-ProteinID: XP_027923717
Position
4
AA seq 470 aa
MKDTIVLYPNIGRGHLVSMVELGKLILSHHPSLSITILILTPSPNATFTQACNSNAQYIA
AVSATIPAITFHSVPMAQLPPDTPSVPPHLISLELSRHSTQNVAFALQSLAKASNIKALV
MDFLNFSNPKTLTQNLTTNFPTFFYYTSAASSLVVLFHLPTTLPKQIQDQEFQLHFPGLP
AISMDIFPNESLDPLSYINQIFGRIAEAMKGSSGIIINTYEAMEEKAIAVLNDDGILPPL
FCVGPVISAPYGEEDKGCLSWLESQPSQSVVLLCFGSMGWFSRRQLMEMAIGLEKSEQRF
LWVVRTELEDGNSVEEKPSLDELLPEGFLDRTKEKGLVVRDWAPQREILSHDSVGGFVTH
CGWNSVLEAVCEGVPMVAWPLYAEQKLNRVLMVEEMKVALALKEEKDGFVSGSELGERVR
ELMESDTGKEIRQRVFKMKLSAAEALVEGGTSRVALDRLAAFCKTSSFTI
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctgtaccctaacattggtaggggtcacctagtatccatggtg
gagctaggcaagctcattctatcccaccacccttctctttccatcaccatcctcatcctc
actccatcacccaacgccactttcacccaagcctgcaactccaacgcccaatacatcgcc
gccgtctccgccaccatccccgccatcaccttccacagcgttcccatggcccaactcccc
cccgacaccccttccgtcccccctcacctcatctcccttgaactctcccgacacagcacc
caaaatgttgcctttgcactccaaagcctcgccaaagcctccaacatcaaagccctagtc
atggacttcttaaacttcagcaaccccaaaactctcactcaaaatctcaccacaaacttc
cccactttcttctactatacttccgcagcctcgagcctcgttgtgctttttcatttgccc
accactctcccaaaacaaatccaagaccaagaatttcaacttcacttcccagggttacct
gcaatatccatggacatctttccaaacgaaagcctcgaccctttgagctacattaaccag
attttcggtcggattgcggaagccatgaagggtagttctgggattataataaacacgtat
gaagcgatggaagagaaagccattgcagtgttgaacgacgatgggatcctgccaccgctg
ttttgcgtgggccctgttatttctgcaccatacggggaggaagacaaaggttgtctgagt
tggctcgagtcgcaaccgagtcagagcgtggtgttgctgtgtttcggaagcatggggtgg
ttctcgaggaggcagttgatggagatggctattgggttagagaagagcgagcaaaggttc
ttgtgggtggtgaggactgagttggaggatggtaactcggtggaagagaaacccagtctg
gacgagttgttgcccgaagggtttctggatcggacgaaggagaaggggttggtggtgcgg
gactgggccccacagagggagattctgagtcatgactcagtggggggctttgtgactcac
tgcgggtggaactcggtgctggaagcggtgtgcgaaggggtgccgatggtggcgtggcca
ttgtacgcggagcagaagctgaatagggtgttaatggttgaggaaatgaaggtggctttg
gcgttgaaggaggagaaagatgggttcgtgagtgggagtgagttgggggagcgagtgagg
gaactcatggaatcggacacggggaaagaaattcgtcagagggttttcaagatgaaactc
agtgctgcagaagcattggttgaaggtggaacctcacgtgttgccttggataggttggct
gcattttgtaaaacgagttctttcactatttaa

DBGET integrated database retrieval system