KEGG   Vigna unguiculata (cowpea): 114187267
Entry
114187267         CDS       T06017                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1-like
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
vun  Vigna unguiculata (cowpea)
Brite
KEGG Orthology (KO) [BR:vun00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    114187267
Enzymes [BR:vun01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     114187267
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth YqgB
Other DBs
NCBI-GeneID: 114187267
NCBI-ProteinID: XP_027931269
Position
6
AA seq 523 aa
MDFSDDIYIEQALVLKEVKHAFQKLVGEDSMESLYVTDIIQRLGIEHHFEHEIEALLRKQ
HSVFSSHLSDFVNGHKLYELALTFRLLRQRGHHVPPDVFECLKSNKREFIAKYGEDVKSL
IALHEATQLSIEGEDSLDDAGYLSCQLLHAWLKRHREHHEAIHVASTLEDPLHYGLSRFR
DASVVLSDYYKTKKEWTCLEKLAEINSCIVRMMNQNEIVQVYKWWKDLGMVKEEKFAKYQ
PLKWYIWPMACFTDPSFSDQRIELTKSISLIYIIDDIFDVYGTLDQLTLFRDAVNRWELA
DTEQLPDFMKMCLRVLFDSTNDFAEKVYKRHGLNPIDTLKRSWVRLLNAFTEEAHWLRSG
DLPRSEEYLNIGIVSTGVPVVLLHAFFLFDHSINLETVAVMDNFPQIVHSVAKILRLSDD
LEGFKKQDQKGVDGSYLDCYMNEHQHVSAEDVQSHVCHLISSEWKRLNEQVLTQNELPSS
FTNFCLNAARMVPLMYHYTTNNPCLSVLREQIKMVHNVDSGHM
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggatttttctgatgatatttatatcgaacaagctctggtgttgaaggaagttaagcat
gcattccagaaacttgtcggtgaagattccatggagagtttatatgtcactgacattatc
cagaggcttggcatcgaacaccattttgaacacgaaattgaagcccttcttcggaagcaa
cactccgtatttagcagtcatctaagtgattttgtgaatggccataaactttatgaactt
gcacttacattccgtttactcagacaaagaggtcatcacgttccaccagatgtatttgag
tgtttgaagagtaataaaagagagttcatagctaaatatggtgaagatgtgaagagtctt
attgccctgcatgaggcaacccagctaagtattgaaggagaagatagtcttgatgatgca
gggtacctcagctgccaacttcttcatgcatggttgaaaagacatagagaacatcatgaa
gctatacatgttgctagcactcttgaggatccacttcactatggcttatcaagattcagg
gacgcaagtgtagttctaagtgattattacaagaccaagaaagaatggacatgcttagag
aaacttgctgagataaattcctgcatagttaggatgatgaaccagaatgaaatcgttcaa
gtttacaaatggtggaaagatcttggaatggtgaaggaggagaagttcgcaaagtatcaa
cccctgaaatggtacatttggccaatggcatgcttcacagatccaagcttttcagatcaa
aggatagaactcaccaaatccatctctctaatctacattatcgatgacatcttcgacgtt
tatgggacattagaccaacttactttatttagagatgctgtcaacagatgggaattggct
gatacagagcagcttccagatttcatgaaaatgtgtctacgtgttcttttcgacagcacc
aatgatttcgccgaaaaggtctacaaaagacatggattaaacccaatagataccctaaaa
agatcgtgggtgcggttgttgaacgcgttcacggaagaggcacattggttgaggagtggt
gatttgccaaggtcagaggagtacttgaacatcggaatcgtgagcacaggagtgcctgtg
gttcttctccatgcattcttcctcttcgatcactctataaatctggaaactgttgctgtc
atggataactttccgcagattgttcactcagtggcgaaaattcttcgtctatctgatgat
ttggaaggattcaagaaacaagatcagaagggagttgatggatcataccttgattgctac
atgaatgagcaccaacacgtttctgctgaagatgtacaaagccatgtttgccacttgatt
tcatctgaatggaaacgtctcaatgaacaagttctgacccaaaatgaattgccatcatca
tttaccaatttctgtctaaatgcagctagaatggtacctttgatgtatcattacaccacc
aataatccatgtctctccgtactaagggaacaaataaaaatggtgcataatgtggattct
ggccatatgtaa

DBGET integrated database retrieval system