KEGG   Vitis vinifera (wine grape): 100257330
Entry
100257330         CDS       T01084                                 
Name
(RefSeq) L-idonate 5-dehydrogenase
  KO
K19635  L-idonate 5-dehydrogenase [EC:1.1.1.366]
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100257330
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.366  L-idonate 5-dehydrogenase (NAD+)
     100257330
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C PALP Methyltransf_25 UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 100257330
NCBI-ProteinID: XP_002267662
UniProt: Q1PSI9 A0A1Z1C5D1 A0A438FHJ7
Position
16:complement(15664250..15668852)
AA seq 366 aa
MGKGGNSEDAVSSKEHGEENMAAWLLGIKTLKIQPYILPSLGPHDVKVRIKAVGICGSDV
HHFKTMRCANFIVKKPMVIGHECAGIIEEVGSEVKNLVVGDRVALEPGISCNRCSLCRNG
QYNLCREMKFFGSPPTNGSLANQVVHPSNLCFKLPDNVSLEEGAMCEPLSVGIHACRRAN
VGPETNVLIMGSGPIGLVTMLAARAFGAPRIVLVDVDDQRLAIAKDLGADDIIRVSTNIQ
DLDEEVAKIQSTMVTGVDVSLDCVGFNKTMSTALNATRAGGKVCLVGLAQSEMTVPLTPA
AAREVDIVGIFRYRNTWPLCLEFLRSGKIDVKPLITHRFTFSQKDVEEAFETSARGGNAI
KVMFNL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggggaaaggaggcaactctgaggatgctgtttcaagcaaggagcatggagaagagaac
atggcagcttggcttctgggcatcaagaccctcaagattcaaccctacattctcccttct
ctgggcccccatgatgttaaagttaggatcaaagctgtagggatatgtggaagtgatgtt
catcacttcaagacaatgaggtgcgcaaattttattgtgaagaagccaatggtgatagga
catgagtgtgctggtatcatagaagaagttgggagtgaagtgaagaatcttgtagtaggt
gaccgggttgctctggagcccggtattagctgtaaccgatgcagtctttgcagaaatggt
caatacaatctatgcagagaaatgaagttttttggatctcctccaaccaatggatctcta
gctaaccaggtggtccatccttcaaatctttgtttcaagctacctgacaatgtgagcttg
gaggaaggagcaatgtgtgagccgctcagtgtcggcatccatgcttgtcgtcgtgctaat
gttggccctgagaccaacgtactgatcatgggatcaggccccatcggcctcgttacaatg
ctggctgctcgtgcttttggagcgccgaggattgtccttgtggatgtagatgatcagcgt
ctagctattgcaaaagatcttggcgcagacgacattatccgggtttcaacgaatattcag
gatctagacgaagaagtggcaaaaatacaaagcacaatggttactggagttgatgtgagc
ttagactgtgttggcttcaacaaaaccatgtcaacagctttgaacgcgactcgagcaggc
ggcaaagtttgccttgtgggtttggcccagagtgagatgactgttcctctcactccagct
gctgccagggaggtcgatatcgttggcatattccgctataggaacacatggccgctctgc
cttgagtttttgaggagtggcaagattgatgttaaacccctgataacccacaggtttact
ttctcacagaaggacgtggaagaagcctttgaaaccagtgctcgtgggggtaatgccatc
aaggtcatgtttaatctctga

DBGET integrated database retrieval system