KEGG   Vitis vinifera (wine grape): 100258789
Entry
100258789         CDS       T01084                                 
Name
(RefSeq) omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2-like
  KO
K21736  Delta12 acyl-lipid conjugase (11E,13E-forming) / acyl-lipid (9+3)-(E)-desaturase [EC:1.14.19.33 1.14.19.34]
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100258789
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.33  Delta12 acyl-lipid conjugase (11E,13E-forming)
     100258789
    1.14.19.34  acyl-lipid (9+3)-(E)-desaturase
     100258789
SSDB
Motif
Pfam: FA_desaturase DUF3474
Other DBs
NCBI-GeneID: 100258789
NCBI-ProteinID: XP_002285640
UniProt: A5C4J4
Position
6:1440358..1443558
AA seq 376 aa
MGAGGRLSVPNSPVQRVPHTKPPFTLGQIKKAIPPHCFQRSIPRSFSYVAYDLSLAFLFY
YIATSYFSLLPSWLTYLAWPLYWTLQGCTLTGVWVIAHECGHHAFSDYQWLDDTVGLILH
SSLLVPYFSWKISHRRHHSNTGSLERDEVFVPKPKSRIPWFSKYLNNPLGRALTLVITLT
LGWPLYLAFNVSGRPYNRFACHYDPYGPIYSDRERLQIYISDAGIFTASYVLYRLILAKG
LAWVVCMYGIPLLIVNAFLVLITYLQHTHPTLPHYDSLEWDWLRGALATVDRDYGVLNKV
FHNITDTHVAHHLFSTMPHYHAMEATRAIKPILGEYYQFDGTPFYKAMWREARECLYVEP
DEGGSDKGVFWYRNKF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgggagccggtggtcgattgtcagtgccgaacagccccgtccagagggttcctcacact
aagcctccattcacacttggccaaatcaagaaggccatcccaccccattgcttccagcgc
tcaattccccggtcattctcatatgttgcctatgacctctccttagcctttctcttctac
tacattgccacctcctatttcagcctccttcctagctggctcacttaccttgcctggccc
ctatactggactctccaaggctgcactctcactggtgtttgggtcattgcccatgagtgt
ggccaccatgccttcagtgactaccagtggcttgatgacacagttgggctcatcctccac
tcctcactcttagtcccctacttctcttggaagatcagccaccgccgccaccactccaac
acagggtcactggaacgtgacgaggtcttcgtgccaaagcccaaatccagaattccctgg
ttttccaaatacttgaacaacccattaggccgagccctcacccttgtcattactctcacc
cttggctggccattgtacttagccttcaatgtgtctggccgcccctataatcgctttgca
tgccactatgatccttatggcccaatatactctgaccgtgagcggcttcaaatctacatc
tctgatgctggaatctttactgcaagctatgtgctttatcgccttatcctggcaaaaggt
ctggcttgggttgtatgtatgtatgggataccgttgctaattgtaaacgccttccttgtc
ctgatcacatacctgcagcacactcatccaacactgcctcactatgattccttagaatgg
gactggctaaggggagctttggcaacggttgatcgtgattacggggtgctaaacaaggtc
ttccacaacattaccgacacacatgtggctcaccatctcttctccacaatgccacattac
catgctatggaggccaccagagcaatcaaacctatactgggtgagtattaccaatttgat
ggtaccccattttacaaggcaatgtggagggaggctagggagtgtctttatgttgagcct
gatgaggggggttcagataaaggtgtcttctggtacaggaacaagttttga

DBGET integrated database retrieval system