KEGG   Xanthobacter autotrophicus: Xaut_4858
Entry
Xaut_4858         CDS       T00581                                 

Name
(GenBank) Toluene-4-monooxygenase system B
  KO
K22359  alkene monooxygenase gamma subunit [EC:1.14.13.69]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00625  Chloroalkane and chloroalkene degradation
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Xaut_4858
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.69  alkene monooxygenase
     Xaut_4858
SSDB
Motif
Pfam: TmoB
Other DBs
NCBI-ProteinID: ABS70069
UniProt: Q9ZET6
Position
pXAUT01:75296..75562
AA seq 88 aa
MSLFPIVGRFVGDFVPHLVAVDTSDTIDQIAEKVAVHTVGRRLPPDPTATGYEVLLDGET
LDGGATLEAIMTKREMLPLQWFDVRFKK
NT seq 267 nt   +upstreamnt  +downstreamnt
atgtctttgttccccatcgtgggccgcttcgtgggggatttcgtcccccacctggtggcg
gtggacacctctgacaccatcgatcagatcgccgagaaggtggcggtccacacggtcggg
cggcgcttgccgcccgatcccaccgccaccggctatgaggtgctcctcgacggcgagacc
ctggacgggggcgccaccctggaggccatcatgaccaagcgcgagatgctgcccctgcag
tggttcgacgtgaggttcaagaagtga

DBGET integrated database retrieval system