KEGG   Xanthobacter autotrophicus: Xaut_4859
Entry
Xaut_4859         CDS       T00581                                 

Name
(GenBank) Rieske (2Fe-2S) domain protein
  KO
K22360  alkene monooxygenase ferredoxin subunit
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00625  Chloroalkane and chloroalkene degradation
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Xaut_4859
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: ABS70070
UniProt: Q9ZET5
Position
pXAUT01:75559..75927
AA seq 122 aa
MNLHAPNAEQDDIEYVDVCAVDDLWDGEMDVFDVGEHEVLLVKHEGRFHAYDGICPHQSV
SLVEGHLTEDGVLICKAHEWQFSVEGGQGINPANVCLQSFPLKVEGGRVLIGTEPLPKEG
EA
NT seq 369 nt   +upstreamnt  +downstreamnt
gtgaaccttcacgcccccaacgccgagcaagacgacatcgagtatgtcgatgtctgcgcg
gtcgatgatctctgggacggtgagatggatgtcttcgacgtgggcgagcacgaggtcctg
ctcgtcaagcacgaaggccggttccatgcctatgacggcatctgcccccatcagtccgtc
tccctggtcgagggccacctgaccgaggacggggtcctgatctgcaaggcgcatgaatgg
caattcagcgtcgagggcggtcaggggatcaatcccgccaacgtctgtctccagtcgttc
cccctcaaggtcgaggggggacgtgtcctgatcggcaccgaaccgctgcccaaagaggga
gaggcctga

DBGET integrated database retrieval system