KEGG   Xanthobacter autotrophicus: Xaut_4860
Entry
Xaut_4860         CDS       T00581                                 

Name
(GenBank) monooxygenase component MmoB/DmpM
  KO
K22361  alkene monooxygenase effector subunit
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00625  Chloroalkane and chloroalkene degradation
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Xaut_4860
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: ABS70071
UniProt: Q9ZET4
Position
pXAUT01:75930..76235
AA seq 101 aa
MSNATVDDMDENLVGPVIRAGDLADAVIDAVIADNPGKEVHVIERGDYVRIHTDRDCRLT
RASIEQALGRSFVLAAIEAEMSSFKGRMSSSDSEMRWYYKS
NT seq 306 nt   +upstreamnt  +downstreamnt
atgagcaacgccaccgtcgacgacatggacgagaaccttgtcggtccagtcattcgcgcc
ggagatcttgccgatgcggtcatcgatgccgtcatcgccgacaatcccggcaaggaagtg
catgtcatcgagcgcggtgactatgtgcgcatccacaccgaccgcgactgccggctgacc
cgcgcctccatcgagcaggccctggggcgcagcttcgtgctcgccgccatcgaggcggag
atgtcctccttcaaggggcgcatgtcctcctcggacagcgaaatgcgctggtactacaag
tcctaa

DBGET integrated database retrieval system