KEGG   Xanthobacter autotrophicus: Xaut_4861
Entry
Xaut_4861         CDS       T00581                                 

Name
(GenBank) methane/phenol/toluene hydroxylase
  KO
K22358  alkene monooxygenase beta subunit [EC:1.14.13.69]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00625  Chloroalkane and chloroalkene degradation
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Xaut_4861
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.69  alkene monooxygenase
     Xaut_4861
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: ABS70072
UniProt: Q9ZET3
Position
pXAUT01:76267..77292
AA seq 341 aa
MTQQRPTRTRERKKTWTAFGNLGRKPTDYEVVTHNMNHTMRGTPLELSPTVHANVWLKKN
RDEIALKVDSWDLFRDPDRTTYDTYVKMQDDQETYVDNLLLSYTGEGRYDEELSSRSLDL
LSAGLTPTRYLGHGLQMLAAYIQQLAPSAYVGNCAVFQTSDALRRVQRVAYRTRQLADAH
PARGFGSGDRAVWEKSPDWQPIRKAIEELLVTFEWDKALAGTNFVVKPILDELFLNHLAR
LLHVEGDELDSLVLRNLHGDAQRHARWTAALGRFAVEQNVNNRTVLRDAIAGWHETGEAV
LAAGAGMLASRAPSADAAKIADEVRATLAQLHANAGLGHDA
NT seq 1026 nt   +upstreamnt  +downstreamnt
gtgacacagcagcgccccacccgcacgcgcgagcgcaagaagacctggacggctttcggc
aatctcggacgcaagccgaccgactacgaggtcgtcacccacaacatgaaccacaccatg
cgcggcacgcccctggagctgtcgccgacggtgcacgccaatgtgtggctcaagaagaac
cgcgacgagatcgcgctcaaggtcgacagctgggatctgttccgcgatcccgaccgcacc
acctacgacacctacgtcaagatgcaggacgaccaggagacctatgtcgacaacctgctc
ctgtcctacaccggcgagggccgctacgacgaggagctttcctcgcgcagcctcgacctc
ctgtccgcggggctgacgccgacccgctatctgggccatgggctgcagatgctcgcggcc
tatatccagcagctcgccccgtcggcctatgtgggcaattgcgcggtgttccagacctcc
gacgcgctgcgccgcgtgcagcgcgtcgcctaccgcacccgccagctcgccgacgcccat
ccggcccgcggcttcggctccggcgaccgggcggtgtgggagaagtccccggactggcag
cccatccgcaaggccatcgaggagctgctcgtcaccttcgaatgggacaaggcgctcgcc
ggcaccaatttcgtggtgaagccgatcctcgacgagctgttcctcaaccacctggcgcgc
ctgctccacgtggagggcgacgagctcgacagcctcgtgctgcggaaccttcacggcgac
gcccagcgccacgcccgctggacggccgcgctcggccgcttcgccgtcgagcagaacgtg
aacaaccgcacggtcctgcgcgacgccatcgccggctggcacgagaccggcgaggcggtc
ctcgccgcgggcgccgggatgcttgcgagccgcgcccccagcgcggatgcggccaagatc
gccgacgaggtccgcgccacgctcgcgcagctgcacgccaatgcgggcctcgggcacgat
gcctga

DBGET integrated database retrieval system