KEGG   Xanthobacter autotrophicus: Xaut_4862
Entry
Xaut_4862         CDS       T00581                                 

Name
(GenBank) Oxidoreductase FAD-binding domain protein
  KO
K22362  alkene monooxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00625  Chloroalkane and chloroalkene degradation
xau01100  Metabolic pathways
xau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Xaut_4862
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Xaut_4862
SSDB
Motif
Pfam: Fer2 FAD_binding_6 NAD_binding_1 Fer2_4
Other DBs
NCBI-ProteinID: ABS70073
UniProt: A7IPX7
Position
pXAUT01:77267..78331
AA seq 354 aa
MRASGTMPEARDAAATAERPGQDGAFHVRLNDGRSFSCRSDQTVLHAALAAGIDMPYECA
SGSCGSCRCRLSHGSVSLLWPEAPGLSARDRQKGDRILACQSTPSSDLEINVRAGDALLE
PPPRRHAARVTVKETLCASVIRLVLNVGGPIHFLPGQFFILDLPGAGRRAYSVANLENAA
GGIELLIKRKIGGAGTAALFDQCAPGMGLVIEGPYGRAYLRADSARGIVAVAGGSGLAPM
LSILRGALARGFGGPMDLYFGVNTAEELFCVPELSALQAAGARVHLALRDGGPGPAGLHR
QAGLIGDALVAGEPDLKAKDLYVAGPAPMTDDILARTVRQEAIPADRVFFDRFV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcgggcctcgggcacgatgcctgaggcgcgtgacgcggccgccacggccgagcgtccg
gggcaggacggggcatttcacgtgcggctgaacgacggcaggagcttttcctgtcgctcg
gaccagaccgtgctccacgccgccctcgcggcggggatcgacatgccctacgaatgcgcc
agcggctcgtgcggctcctgccgatgccgtctgagccacgggagcgtctcgctcctgtgg
ccggaggccccgggcctcagcgcgcgcgaccggcagaagggcgatcgcatcctcgcctgc
cagtccacgccttcgtccgatctcgagatcaacgtgcgggccggcgatgcgctcctcgag
ccaccgccccggcgccacgccgcccgcgtcaccgtgaaggagacgctgtgcgcctcggtg
atccggctcgtcctgaatgtcggcgggccgatccatttcctgcccgggcagttcttcatc
ctcgatctgccgggcgcgggccggcgcgcctattcggtggccaatcttgagaatgccgcc
ggagggatcgagctcctgatcaagcgcaagatcggcggcgccggcacggccgcgctgttc
gaccagtgcgcgccgggcatgggcctcgtcatcgaggggccctacgggcgggcctatctg
cgcgcggacagcgcgcgcggcatcgtcgcggtggcgggggggtcgggccttgcgcccatg
ctctccatcctgcgcggcgcgctcgcccgaggatttggcgggcccatggacctctatttc
ggcgtcaacaccgccgaggagctgttctgcgtgcccgagctttccgcccttcaggccgcg
ggcgcgcgggtgcatctggctctgcgggacggcgggccggggccggccgggctccatcgg
caggctggcctgatcggcgacgcgctcgtcgccggcgagcccgacctgaaggcgaaggac
ctctatgtggccgggcccgcgcccatgaccgacgacatcctcgcccgcacggtgcggcag
gaggccattcccgcggaccgggtgtttttcgaccgtttcgtgtga

DBGET integrated database retrieval system