KEGG   Xanthobacter autotrophicus: Xaut_4865
Entry
Xaut_4865         CDS       T00581                                 

Name
(GenBank) 2-hydroxypropyl-CoM lyase
  KO
K22363  2-hydroxypropyl-CoM lyase [EC:4.4.1.23]
Organism
xau  Xanthobacter autotrophicus
Pathway
xau00625  Chloroalkane and chloroalkene degradation
xau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Xaut_4865
Enzymes [BR:xau01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.23  2-hydroxypropyl-CoM lyase
     Xaut_4865
SSDB
Motif
Pfam: Meth_synt_2
Other DBs
NCBI-ProteinID: ABS70076
UniProt: Q56837
Position
pXAUT01:81145..82275
AA seq 376 aa
MLIRGEDVTIPTSMVGNYPNPRWWDAQFARTWTGDQEPPDALIQESLEDAVAAIARDQER
AGLDIISDGRVHGDNYAEQALYYYYRRLGYDLKGGYLGFPIYSRLHAGTLTGEVRRHGAI
MVEQAKALKKATGKPTKVQYTGVQALTQATNDLHYKSSRDRAMAIAKAINEDIREVDALG
VDFIQIDEFTWPYFFEDWAIEAFNAAVDGVKNAKIIAHVCWGNWGGTPAYYPDETAASGE
IFDLTKRKAEATKATATGSIVPKAYEARLDVLNLESCGRRSDDLSGLHVMKNHPLPDNVS
FWAGVIDVKSTITETADEVANRIRRLLEIVPADRLGVTTDCGLILLQRYIAQDKLHALVE
GTKIVRAELAKAKQAA
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgctgatccgaggggaagacgtcacgattccgaccagtatggtcggcaactatcccaat
ccgcggtggtgggacgcccagttcgcccgcacctggacgggtgatcaggagccgccggac
gcgctgatccaggaatccctcgaggatgcggtggctgccatcgcccgcgatcaggagcgc
gccggcctcgacatcatcagcgacggccgcgtgcacggcgacaattacgccgaacaggcc
ctttattattactaccggcgcctcggctacgacctcaagggcggctatctcggctttccg
atctacagccggcttcacgcgggcaccctcaccggcgaggtccggcgccacggcgcgatc
atggtcgagcaggccaaggcgctgaagaaggccactggcaagcccaccaaggtgcagtat
acgggcgtccaggcgctcacccaggcgaccaacgacctgcactacaagtcgagccgcgat
cgcgccatggccatcgccaaggccatcaacgaggacatccgcgaggtggacgcgctcggc
gtcgacttcattcagatcgacgagttcacctggccctatttcttcgaggactgggccatc
gaagccttcaacgcggcggtggacggcgtgaagaacgccaagatcatcgcccatgtgtgc
tggggcaactggggcggcacgcccgcttactatcccgacgagacggcggccagcggcgag
atcttcgatctcaccaagcgcaaggcggaagccaccaaggccaccgccaccggctccatc
gtgccgaaggcctacgaggcccggctcgacgtgctcaacctggaaagctgcgggcgccgc
tccgatgatctcagcggccttcacgtgatgaagaaccatcccctgccggacaatgtctcg
ttctgggcgggcgtcatcgacgtgaagagcaccatcacggagacggccgacgaggtggca
aaccgcattcgccggctgctggagatcgtcccggcggaccgcctcggcgtgaccaccgac
tgcggcctcattctgctccagcgctatatcgcccaggacaagctgcacgccctcgtcgag
ggcaccaagattgtccgagcagagctcgccaaggccaagcaggcggcctga

DBGET integrated database retrieval system