KEGG   Xanthobacter autotrophicus: Xaut_4867
Entry
Xaut_4867         CDS       T00581                                 

Name
(GenBank) pyridine nucleotide-disulphide oxidoreductase dimerisation region
  KO
K22364  2-oxopropyl-CoM reductase (carboxylating) [EC:1.8.1.5]
Organism
xau  Xanthobacter autotrophicus
Brite
KEGG Orthology (KO) [BR:xau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Xaut_4867
Enzymes [BR:xau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.5  2-oxopropyl-CoM reductase (carboxylating)
     Xaut_4867
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox DAO MM_CoA_mutase GMC_oxred_N
Other DBs
NCBI-ProteinID: ABS70078
UniProt: Q56839
Structure
PDB: 
1MO9 3Q6J 2C3C 2C3D 1MOK

Position
pXAUT01:82602..84173
AA seq 523 aa
MKVWNARNDHLTINQWATRIDEILEAPDGGEVIYNVDENDPREYDAIFIGGGAAGRFGSA
YLRAMGGRQLIVDRWPFLGGSCPHNACVPHHLFSDCAAELMLARTFSGQYWFPDMTEKVV
GIKEVVDLFRAGRNGPHGIMNFQSKEQLNLEYILNCPAKVIDNHTVEAAGKVFKAKNLIL
AVGAGPGTLDVPGVNAKGVFDHATLVEELDYEPGSTVVVVGGSKTAVEYGCFFNATGRRT
VMLVRTEPLKLIKDNETRAYVLDRMKEQGMEIISGSNVTRIEEDANGRVQAVVAMTPNGE
MRIETDFVFLGLGEQPRSAELAKILGLDLGPKGEVLVNEYLQTSVPNVYAVGDLIGGPME
MFKARKSGCYAARNVMGEKISYTPKNYPDFLHTHYEVSFLGMGEEEARAAGHEIVTIKMP
PDTENGLNVALPASDRTMLYAFGKGTAHMSGFQKIVIDAKTRKVLGAHHVGYGAKDAFQY
LNVLIKQGLTVDELGDMDELFLNPTHFIQLSRLRAGSKNLVSL
NT seq 1572 nt   +upstreamnt  +downstreamnt
gtgaaagtctggaacgcccgaaacgaccatctcaccatcaatcaatgggccacgcggatc
gatgagatcctcgaggcgcccgatggcggagaggtcatctacaacgtggacgagaacgat
ccacgcgaatacgacgccatcttcatcggcggcggcgccgccgggcgcttcggctcggcc
tatctgcgcgccatgggcggccggcagctcatcgtcgaccgctggccgttcctgggcggc
tcgtgcccgcacaatgcgtgcgtgccgcaccatctgttctccgactgcgcggccgagctg
atgctcgcgcgcaccttctcgggccagtactggttcccggacatgaccgagaaggtggtc
ggcatcaaggaggtggtcgatctgttccgcgccgggcgcaacggcccgcacggcatcatg
aacttccagtccaaggaacagctcaacctcgaatacatcctcaactgcccggccaaggtg
atcgataatcacaccgtcgaggcggccggcaaggtgttcaaggccaagaacctgatcctc
gcggtgggcgcggggccgggcacgctcgacgtgccgggcgtcaacgccaagggcgtcttc
gaccacgcgacgctggtggaggagctcgactacgagcccggcagcaccgtggtcgtggtg
ggcggctcgaagaccgcggtcgaatatggctgcttcttcaacgccaccggccggcgcacc
gtgatgctggtgcgcaccgagccgctcaagctcatcaaggacaacgagacccgcgcctac
gtgctcgaccgcatgaaggagcagggcatggagatcatctccggctccaacgtcacgcgc
atcgaggaggacgccaacggccgcgttcaggcggtggtggccatgacgcccaacggcgag
atgcgcatcgagaccgacttcgtcttcctcggcctcggcgagcagccccgctcggcggag
ctggcgaagatcctgggcctcgatctcggccccaagggcgaggtgctggtcaacgaatat
cttcagaccagcgtgcccaacgtctacgcggtgggcgacctcatcggcgggcccatggag
atgttcaaggcccgcaagtccggctgctatgccgcgcgcaacgtcatgggcgagaagatc
tcctacacgcccaagaattatcccgacttcctgcacacccattacgaggtcagcttcctc
ggcatgggcgaggaggaagcccgcgcggcggggcacgagatcgtcaccatcaagatgccg
ccggacacggagaacggcctcaacgtggcgctgccggcctccgaccgcaccatgctctac
gccttcggcaagggcacggcccacatgtcgggcttccagaagatcgtcatcgacgccaag
acccgcaaggtgctcggcgcccatcacgtgggctatggcgcgaaggacgcgttccaatac
ctgaacgtgctcatcaagcaggggctcaccgtcgacgaactgggggacatggacgaattg
ttcctcaatccgacccacttcatccagctctcgcgcctgcgcgcgggctcgaagaatctg
gtgagcctgtga

DBGET integrated database retrieval system