KEGG   Yarrowia lipolytica: YALI0E02508g
Entry
YALI0E02508g      CDS       T01033                                 

Name
(RefSeq) YALI0E02508p
  KO
K10868  DNA repair protein XRS2
Organism
yli  Yarrowia lipolytica
Pathway
yli03440  Homologous recombination
yli03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:yli00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YALI0E02508g
   03450 Non-homologous end-joining
    YALI0E02508g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:yli03400]
    YALI0E02508g
DNA repair and recombination proteins [BR:yli03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     YALI0E02508g
   NHEJ (non-homologous end-joining)
    MRX complex
     YALI0E02508g
SSDB
Motif
Pfam: NIBRIN_BRCT_II FHA BRCT Yop-YscD_cpl
Other DBs
NCBI-GeneID: 2912106
NCBI-ProteinID: XP_503461
UniProt: Q6C7A1
Position
E:complement(join(277666..279623,279717..279747))
AA seq 662 aa
MWVWSHGEATYHLFPSEFIIGRDKSHVLNMDGKSISRNHVQLIIDKDDSKCEIVSIKKPR
IDTGVYVNGLQLKSEERFSIHRSTTYRVQVGRKEDSYFTLKWRPLSFSYHEDEEETLLNE
IIKGSDIRMQRYFSEDTTHYVKGKKNSSKLLLAMIKGVYVVGQQFLNELLNRKNEGLAVI
WPDESDYVPEPELAIDTSRIQLWAGMTFAFSDRQQLEMLGPVITEGDGKAICLYLEDDTS
TTRTIVDDLQRHAGKKVVVRSHEKKYQQIIMDAMGELANKDIIVIDAADLLPAVKECNPS
ILWHKAQSLSKNIPRPKVERLDTVLMPPEEPENKKPSKPASRPAVNRVKRAPPKQMDLLN
FFVKEETDSPPQPEITSSQDKQSQPPSSKGSSQRRPLKQRARVEPIDNLLLFQQPLKRQK
VDNNAETEGKETADSAEELVIDDADIVMDNIDLHEESLISEAAPQNTHKPVDFSSAVQNI
KSEHAKEEEANLDTESLAQLSIEVKEGSIAVRRPPPLQATRMMSVVNAARYDGRRNFKKF
KKQLPGYAENTTHGSFSRFDRRFVALVPDKPAQSDQTSIDDMLHAGENLTDRRIRILRER
GEPQKKYRALDDDGEDGAEEADDDDLFLKDSEPEEESEVQTSHAAITIDDDSEDETAFKF
SK
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgtgggtttggagccatggtgaagcgacttaccatctattcccttcggaattcatcata
ggccgtgataagagtcacgttctcaacatggatggaaaatccatcagccggaatcatgtt
cagcttatcattgacaaggacgactcgaaatgtgaaattgtcagcatcaagaagcctcga
atcgacacaggtgtgtatgtcaacggactgcagctgaaatctgaggagcgattctcgata
cacagaagcacgacttacagggttcaagtggggcgaaaggaggactcatatttcacattg
aaatggcgaccgctatcgttttcgtaccatgaagatgaggaggagacactattaaatgag
attatcaaggggtctgatattaggatgcaacgatacttttcagaagacacgactcattat
gttaaggggaagaagaactcctccaagctgctcctggctatgatcaagggggtgtatgtg
gtgggacaacaatttctcaatgagcttctcaatcgcaagaacgaaggactggctgtgatc
tggcctgatgagagcgactacgtgcccgaacctgaactggcaatcgacacaagccgaatc
cagctctgggctggcatgacatttgctttttcagaccgacagcagctagaaatgctgggt
cctgtcatcacagaaggtgatggaaaggctatatgcctgtatttagaggatgacacctcc
acgaccaggactattgtggacgatttacagagacatgcgggcaagaaggttgtggtacgt
tctcacgagaagaagtatcaacagattattatggatgctatgggagaattggctaataag
gacatcattgtgatcgacgcagctgacttgctacctgctgtgaaagagtgtaaccctagc
atcctgtggcacaaggctcagtcgttgtctaaaaacattccaagaccaaaagttgaacga
ctagacactgtgctaatgcctccagaagaaccagagaataagaagccttccaaacctgcc
tctcgccctgctgtgaacagagtcaagcgagcacctccaaaacagatggatctgctgaat
ttctttgttaaggaagagactgattcccctccacaaccagaaattactagctcgcaagat
aagcaaagtcaacctccttcttctaaaggatcttcgcagaggcgacctttaaaacagaga
gctcgggtggagcccatagacaacctccttctattccaacaacccctgaagaggcagaag
gttgacaacaatgctgaaacggaggggaaagagacagccgattcagctgaggagttggtg
attgatgatgcagacatcgtcatggataatatcgatctgcacgaagagtcgcttatttcc
gaagctgctccacaaaacacccataaacccgtcgacttttcatcagctgtccagaacatc
aaatcagaacacgccaaggaggaggaggcgaatctagacaccgaatctttggcccagctt
tctattgaagtcaaggaaggatctattgctgtccgaagaccaccacctttgcaagctact
cgaatgatgtctgttgttaacgcggcaagatatgacggtcgcagaaactttaagaaattc
aaaaagcagcttcctggctacgccgagaatacgacccatgggtcgttttcgcgattcgac
aggcgattcgtggcactggttcctgataaacctgcgcaatctgatcaaacatcaatcgat
gacatgctccatgcaggggaaaacttgacggacagaagaatccgaattctacgcgaaaga
ggcgagcctcagaagaagtatcgggcattggatgatgatggagaggatggtgctgaggag
gctgatgatgacgacctgttcttgaaagactccgagcctgaagaggagtcggaggttcag
acatctcatgctgcaataactatcgatgatgatagcgaagacgaaaccgccttcaagttt
tctaagtga

DBGET integrated database retrieval system